UniGene Name: sp_v3.0_unigene109529
Length: 236 nt
UniGene Fasta |
---|
>sp_v3.0_unigene109529
A |
Ace file of the UniGene sp_v3.0_unigene109529 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Cytochrome P450 n=1 Tax=Populus trichocarpa RepID=B9NBY7_POPTR | - | - | 1.0e-15 | 56% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 75% |
Sma3 | Cytochrome P450 | - | - | 4.069e-35 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | EC:1.14.-.- | - | 8.437e-10 | - | |
Sma3 | 4-hydroxyphenylacetaldehyde oxime monooxygenase. | EC:1.14.13.68 | - | 1.092e-17 | - |
Source | KEGGs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Cyanoamino acid metabolism | 00460 | 1.092e-17 | % | |
Sma3 | Biosynthesis of secondary metabolites | 01110 | 1.092e-17 | % | |
Sma3 | N-methylcoclaurine 3'-monooxygenase. | EC:1.14.13.71 | - | 3.114e-07 | - |
Source | KEGGs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Isoquinoline alkaloid biosynthesis | 00950 | 3.114e-07 | % | |
Sma3 | Metabolic pathways | 01100 | 3.114e-07 | % | |
Sma3 | Biosynthesis of secondary metabolites | 01110 | 3.114e-07 | % | |
Sma3 | Flavonoid 3',5'-hydroxylase. | EC:1.14.13.88 | - | 5.179e-07 | - |
Source | KEGGs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Flavonoid biosynthesis | 00941 | 5.179e-07 | % | |
Sma3 | Flavone and flavonol biosynthesis | 00944 | 5.179e-07 | % | |
Sma3 | Biosynthesis of secondary metabolites | 01110 | 5.179e-07 | % | |
Sma3 | Isoflavone 2'-hydroxylase. | EC:1.14.13.89 | - | 2.267e-07 | - |
Source | KEGGs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Isoflavonoid biosynthesis | 00943 | 2.267e-07 | % | |
Sma3 | Biosynthesis of phenylpropanoids | 01061 | 2.267e-07 | % | |
Sma3 | Biosynthesis of secondary metabolites | 01110 | 2.267e-07 | % |
Source | Gene names |
---|---|
Sma3 | AT4g22690; AT4g22710; AT4g37330; AT4g37360; Asp-3; At3g26160; At3g26220; At4g22690; At4g22710; At4g37330; At4g37360; B1097H10.9; B1307A11.31; C7A10.10; C7A10.30; CYP Ge-31; CYP71A1; CYP71AP2v1; CYP71AP3; CYP71B17; CYP71B3; CYP71C9v1; CYP71C9v2; CYP71C9v3; |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | cell wall | GO:0005618 | Cellular Component | 0.0 | - |
Sma3 | mitochondrion | GO:0005739 | Cellular Component | 0.0 | - |
Sma3 | endoplasmic reticulum | GO:0005783 | Cellular Component | 0.0 | - |
Sma3 | endoplasmic reticulum membrane | GO:0005789 | Cellular Component | 0.0 | - |
Sma3 | microsome | GO:0005792 | Cellular Component | 0.0 | - |
Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
Sma3 | sequence-specific DNA binding transcription factor activity | GO:0003700 | Molecular Function | 0.0 | - |
Sma3 | RNA binding | GO:0003723 | Molecular Function | 0.0 | - |
Sma3 | RNA-directed DNA polymerase activity | GO:0003964 | Molecular Function | 0.0 | - |
Sma3 | aspartic-type endopeptidase activity | GO:0004190 | Molecular Function | 0.0 | - |
Sma3 | monooxygenase activity | GO:0004497 | Molecular Function | 0.0 | - |
Sma3 | iron ion binding | GO:0005506 | Molecular Function | 0.0 | - |
Sma3 | electron carrier activity | GO:0009055 | Molecular Function | 0.0 | - |
Sma3 | heme binding | GO:0020037 | Molecular Function | 0.0 | - |
Sma3 | isoflavone 2'-hydroxylase activity | GO:0033773 | Molecular Function | 0.0 | - |
Sma3 | 4-hydroxyphenylacetaldehyde oxime monooxygenase activity | GO:0050592 | Molecular Function | 0.0 | - |
Sma3 | N-methylcoclaurine 3'-monooxygenase activity | GO:0050593 | Molecular Function | 0.0 | - |
Sma3 | tabersonine 16-hydroxylase activity | GO:0050594 | Molecular Function | 0.0 | - |
Sma3 | RNA-dependent DNA replication | GO:0006278 | Biological Process | 0.0 | - |
Sma3 | proteolysis | GO:0006508 | Biological Process | 0.0 | - |
Sma3 | fruit ripening | GO:0009835 | Biological Process | 0.0 | - |
Sma3 | GO:0045449 | Biological Process | 0.0 | - | |
Sma3 | oxidation-reduction process | GO:0055114 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Protease inhibitor I4, serpin | IPR000215 | - | 0.0 | - |
Sma3 | Reverse transcriptase | IPR000477 | - | 0.0 | - |
Sma3 | Cytochrome P450 | IPR001128 | - | 0.0 | - |
Sma3 | Aminoacyl-tRNA synthetase, class I, conserved site | IPR001412 | - | 0.0 | - |
Sma3 | Zinc finger, CCHC-type | IPR001878 | - | 0.0 | - |
Sma3 | Cytochrome P450, E-class, group I | IPR002401 | - | 0.0 | - |
Sma3 | Cytochrome P450, E-class, group IV | IPR002403 | - | 0.0 | - |
Sma3 | Cytochrome P450, conserved site | IPR017972 | - | 0.0 | - |
Sma3 | IPR017973 | - | 0.0 | - | |
Sma3 | EF-Hand 1, calcium-binding site | IPR018247 | - | 0.0 | - |
Sma3 | Peptidase S26A, signal peptidase I, conserved site | IPR019758 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT4G22710.1 | CYP706A2 cytochrome P450, family 706, subfamily A, polypeptide 2 chr4:11935038-11936618 FORWARD LENGTH=526 | 3.0e-17 | 55% |
RefSeq | Arabidopsis thaliana | NP_194002.1 | cytochrome P450, family 706, subfamily A, polypeptide 2 [Arabidopsis thaliana] | 4.0e-17 | 55% |
RefSeq | Populus trichocarpa | XP_002332769.1 | cytochrome P450 [Populus trichocarpa] | 2.0e-21 | 66% |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: C0PQT4
Fln msg: Distance to subject end: 92 aas, your sequence is shorter than subject: 78 - 528
Fln protein:
C
Protein Length:
79
Fln nts:
A
Fln Alignment:
AllPine_a_c42838___PHLQYLQSVVKETXXXXXXXXXXXXHESMEHSTVGGYQIPQKTRVIVNAWAIGRDPLVWEEANVFKPERFLGS
C0PQT4________________PHLPYLQAVVKETLRLYPSAPLLAPHESMESCTVCDYEIPARTRVIVNAWAIGRDPKSWEDAEEFKPERFTES
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain