UniGene Name: sp_v3.0_unigene109006
Length: 227 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
![]() |
---|
>sp_v3.0_unigene109006
G |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | anther-specific myb-related protein 1 [Nicotiana tabacum] | - | - | 1.0e-35 | 89% |
FL-Next | tr=R2R3-MYB transcription factor MYB1; Picea glauca (White spruce) (Pinus glauca). | - | - | 0.0 | 71% |
Sma3 | Putative transcription factor | - | - | 7.588e-17 | - |
Source | Gene names |
---|---|
Sma3 | AT4g26930; At1g09540; At1g22640; At2g16720; At2g26950; At2g26960; At2g32460; At3g02940; At3g11440; At3g61250; At4g01680; At4g01680/T15B16.4; At4g09460; At4g22680; At4g26930; At4g34990; At4g38620; At5g06100; At5g06100/K16F4_6; At5g55020; At5g62320; F10M23. |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
Sma3 | DNA binding | GO:0003677 | Molecular Function | 0.0 | - |
Sma3 | sequence-specific DNA binding transcription factor activity | GO:0003700 | Molecular Function | 0.0 | - |
Sma3 | catalytic activity | GO:0003824 | Molecular Function | 0.0 | - |
Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
Sma3 | cysteine-type peptidase activity | GO:0008234 | Molecular Function | 0.0 | - |
Sma3 | regulation of transcription, DNA-dependent | GO:0006355 | Biological Process | 0.0 | - |
Sma3 | proteolysis | GO:0006508 | Biological Process | 0.0 | - |
Sma3 | response to wounding | GO:0009611 | Biological Process | 0.0 | - |
Sma3 | response to salt stress | GO:0009651 | Biological Process | 0.0 | - |
Sma3 | response to ethylene stimulus | GO:0009723 | Biological Process | 0.0 | - |
Sma3 | response to auxin stimulus | GO:0009733 | Biological Process | 0.0 | - |
Sma3 | response to abscisic acid stimulus | GO:0009737 | Biological Process | 0.0 | - |
Sma3 | response to gibberellin stimulus | GO:0009739 | Biological Process | 0.0 | - |
Sma3 | gibberellic acid mediated signaling pathway | GO:0009740 | Biological Process | 0.0 | - |
Sma3 | response to salicylic acid stimulus | GO:0009751 | Biological Process | 0.0 | - |
Sma3 | response to jasmonic acid stimulus | GO:0009753 | Biological Process | 0.0 | - |
Sma3 | positive regulation of abscisic acid mediated signaling pathway | GO:0009789 | Biological Process | 0.0 | - |
Sma3 | cinnamic acid biosynthetic process | GO:0009800 | Biological Process | 0.0 | - |
Sma3 | negative regulation of metabolic process | GO:0009892 | Biological Process | 0.0 | - |
Sma3 | flower development | GO:0009908 | Biological Process | 0.0 | - |
Sma3 | response to UV-B | GO:0010224 | Biological Process | 0.0 | - |
Sma3 | GO:0016481 | Biological Process | 0.0 | - | |
Sma3 | cell differentiation | GO:0030154 | Biological Process | 0.0 | - |
Sma3 | GO:0045449 | Biological Process | 0.0 | - | |
Sma3 | response to cadmium ion | GO:0046686 | Biological Process | 0.0 | - |
Sma3 | pollen sperm cell differentiation | GO:0048235 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Inositol monophosphatase | IPR000760 | - | 0.0 | - |
Sma3 | SANT/Myb domain | IPR001005 | - | 0.0 | - |
Sma3 | Phosphoglycerate/bisphosphoglycerate mutase, active site | IPR001345 | - | 0.0 | - |
Sma3 | Peptidase C48, SUMO/Sentrin/Ubl1 | IPR003653 | - | 0.0 | - |
Sma3 | Transposon, En/Spm-like | IPR004242 | - | 0.0 | - |
Sma3 | IPR012287 | - | 0.0 | - | |
Sma3 | IPR014778 | - | 0.0 | - | |
Sma3 | Myb transcription factor | IPR015495 | - | 0.0 | - |
Sma3 | Transcription factor, GAMYB | IPR016310 | - | 0.0 | - |
Sma3 | Myb domain, DNA-binding | IPR017930 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT5G06100.2 | - | 2.94273e-44 | 89% |
RefSeq | Arabidopsis thaliana | NP_196228.1 | myb domain protein 33 [Arabidopsis thaliana] | 1.96182e-44 | 89% |
RefSeq | Populus trichocarpa | XP_002297703.1 | predicted protein, partial [Populus trichocarpa] | 2.8026e-45 | 92% |
![]() |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: A5JYE5
Fln msg: Distance to subject end: 207 aas, your sequence is shorter than subject: 75 - 332
Fln protein:
G
Protein Length:
76
Fln nts:
G
Fln Alignment:
AllPine_a_c42171___GKSCRLRWANHLRPNLKKGAFTAEEEQIIIELHAKLGNKWARMAAQLPGRTDNEIKNYWNTRIKRRQRQ
A5JYE5________________GKSCRLRWTNYLRPDLKRGLLSESEEKLIIDLHAAIGNRWSRIAAQLPGRTDNEIKNYWNTRIKKKLRQ
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain