|
||||||
|
UniGene Name: sp_v3.0_unigene108849
Length: 236 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene108849
C |
|
Ace file of the UniGene sp_v3.0_unigene108849
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Unassigned protein | - | - | 0.0 | - |
| FL-Next | tr=Putative uncharacterized protein; Vitis vinifera (Grape). | - | - | 0.0 | 74% |
| Sma3 | Putative MAP3K epsilon protein kinase | - | - | 5.308e-09 | - |
| Source | Gene names |
|---|---|
| Sma3 | 24K23.24; At3g07980; At3g13530; F17A17.32; GSVIVT00030218001; H0112G12.4; MAP3K epsilon; MAP3Ke1; OSJNBa0015K02.14; Os04g0660500; OsI_17770; OsJ_16493; PHYPADRAFT_127611; RCOM_0807920; |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | vacuole | GO:0005773 | Cellular Component | 0.0 | - |
| Sma3 | cytosol | GO:0005829 | Cellular Component | 0.0 | - |
| Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
| Sma3 | protein serine/threonine kinase activity | GO:0004674 | Molecular Function | 0.0 | - |
| Sma3 | protein tyrosine kinase activity | GO:0004713 | Molecular Function | 0.0 | - |
| Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
| Sma3 | protein phosphorylation | GO:0006468 | Biological Process | 0.0 | - |
| Sma3 | plasma membrane organization | GO:0007009 | Biological Process | 0.0 | - |
| Sma3 | pollen development | GO:0009555 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Armadillo | IPR000225 | - | 0.0 | - |
| Sma3 | Protein kinase, catalytic domain | IPR000719 | - | 0.0 | - |
| Sma3 | Serine-threonine/tyrosine-protein kinase catalytic domain | IPR001245 | - | 0.0 | - |
| Sma3 | Serine/threonine- / dual-specificity protein kinase, catalytic domain | IPR002290 | - | 0.0 | - |
| Sma3 | Ribosomal protein S12/S23 | IPR006032 | - | 0.0 | - |
| Sma3 | Serine/threonine-protein kinase, active site | IPR008271 | - | 0.0 | - |
| Sma3 | Armadillo-like helical | IPR011989 | - | 0.0 | - |
| Sma3 | Protein kinase, ATP binding site | IPR017441 | - | 0.0 | - |
| Sma3 | IPR017442 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT3G13530.1 | MAPKKK7, MAP3KE1 mitogen-activated protein kinase kinase kinase 7 chr3:4411934-4419320 REVERSE LENGTH=1368 | 9.0e-22 | 60% |
| RefSeq | Arabidopsis thaliana | NP_187962.1 | mitogen-activated protein kinase kinase kinase 7 [Arabidopsis thaliana] | 1.0e-21 | 60% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: tr_plants
Fln subject: F6HF39
Fln msg: Distance to subject end: 715 aas, your sequence is shorter than subject: 78 - 1405
Fln protein:
Q
Protein Length:
79
Fln nts:
C
Fln Alignment:
AllPine_a_c41973___QHGLVPLMEMLEVANNRVIVSVLQIVNQLIKDNAPFQENACHIGLIPVVMNFAASDHSREIRMQAAY
F6HF39________________QHGLLPLMELLEVSRTRVICSVLQIVNQIIKDNTDFQENACLVGLIPVVMSFAVPDHPREVRMEAAY
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
