SustainPineDB

All assemblies
Assembly info
Unigenes
SNPs
SSRs
Descriptions
GOs
ECs
KEGGs
InterPros
miRNAs

Assembly Name: SustainPine v3.0

UniGene Name: sp_v3.0_unigene108514

Length: 427 nt

UniGene Fasta

>sp_v3.0_unigene108514
TCCAAACAAATTCTTGTTGTTGCCATTACATGGGTCCATGCCTACAGTAAATCAGCGAGAGATATTTCAGCGACCGCCTAATGGGATGAGGAAAATCATACTTGCTACCAATATTGCGGAGACAAGTATCACAATAGACGATGTTGTTTTTGTAGTTGATTGCGGGAAAGCAAAAGAAACAAGCTATGATGCTTTAAACAAGCTTGCTTGTCTCACCCCCTCCTGGATCTCAAAGGCATCGGCTCATCAGAGGCGAGGACGAGCTGGACGTGTTCAACCTGGAGTTTGCTATCACCTATATCCAAAGATCATCTATGATGCCATGCCTCTATATCAGTTGCCGGAAATTCTTCGGACACCATTGCAAGAACTTTGCCTACAAATCAAAAGTCTGCAATTTGGAAGTATTTCTGCCTTCTTATCTAAA

Ace file of the UniGene sp_v3.0_unigene108514

If you push the Download ace button, you will download an ace file of this UniGene.

To watch this ACE file you will need an ACE viewer program as Tablet:

Go to the Tablet ACE viewer Web

Annotations

Source	Descriptions	Term	Type	e value	Identity
AutoFact	Putative ATP-dependent RNA helicase n=1 Tax=Oryza sativa RepID=Q9FW67_ORYSA	-	-	0.0	83%
FL-Next	sp=Putative uncharacterized protein At4g01020, chloroplastic; Arabidopsis thaliana (Mouse-ear cress).	-	-	0.0	45%
Sma3	ATP-dependent RNA helicase, putative	-	-	2.923e-18	-

Source	Gene names
Sma3	117M18_19; AT4g01020; At1g58050; At2g01130; At2g30800; At2g35920; At4g01020; B0308C03.3; B1143G03.7-1; CHLREDRAFT_107301; CHLREDRAFT_120088; CHLREDRAFT_172167; Dhx57; F11I4_16; GSVIVT00003545001; GSVIVT00009138001; GSVIVT00017756001; GSVIVT00018850001; GS

Source	GOs	Term	Type	Identity
Sma3	intracellular	GO:0005622	Cellular Component	-
Sma3	nucleus	GO:0005634	Cellular Component	-
Sma3	nucleic acid binding	GO:0003676	Molecular Function	-
Sma3	RNA binding	GO:0003723	Molecular Function	-
Sma3	double-stranded RNA binding	GO:0003725	Molecular Function	-
Sma3	helicase activity	GO:0004386	Molecular Function	-
Sma3	protein binding	GO:0005515	Molecular Function	-
Sma3	ATP binding	GO:0005524	Molecular Function	-
Sma3	ATP-dependent helicase activity	GO:0008026	Molecular Function	-
Sma3	zinc ion binding	GO:0008270	Molecular Function	-
Sma3	oxidoreductase activity	GO:0016491	Molecular Function	-
Sma3	chalcone isomerase activity	GO:0045430	Molecular Function	-
Sma3	flavonoid biosynthetic process	GO:0009813	Biological Process	-

Source	InterPros	Term	Type	Identity
Sma3	Ubiquitin-associated/translation elongation factor EF1B, N-terminal	IPR000449	-	-
Sma3	Fructose-bisphosphate aldolase, class-I	IPR000741	-	-
Sma3	Double-stranded RNA-binding	IPR001159	-	-
Sma3	Single-stranded nucleic acid binding R3H	IPR001374	-	-
Sma3	Helicase, C-terminal	IPR001650	-	-
Sma3	Zinc finger, RING-type	IPR001841	-	-
Sma3	Ankyrin repeat	IPR002110	-	-
Sma3	DNA/RNA helicase, ATP-dependent, DEAH-box type, conserved site	IPR002464	-	-
Sma3	Zinc finger, C6HC-type	IPR002867	-	-
Sma3	Chalcone isomerase, subgroup	IPR003466	-	-
Sma3	AAA+ ATPase domain	IPR003593	-	-
Sma3	K Homology domain	IPR004087	-	-
Sma3	RWD domain	IPR006575	-	-
Sma3	Zinc finger, C2H2	IPR007087	-	-
Sma3	Helicase-associated domain	IPR007502	-	-
Sma3	DNA/RNA helicase, DEAD/DEAH box type, N-terminal	IPR011545	-	-
Sma3	Domain of unknown function DUF1605	IPR011709	-	-
Sma3	Aldolase-type TIM barrel	IPR013785	-	-
Sma3	Helicase, superfamily 1/2, ATP-binding domain	IPR014001	-	-
Sma3		IPR014021	-	-
Sma3	Double-stranded RNA-binding-like	IPR014720	-	-
Sma3	Zinc finger, C2H2-like	IPR015880	-	-
Sma3	Ubiquitin-associated/translation elongation factor EF1B, N-terminal, eukaryote	IPR015940	-	-
Sma3	Ubiquitin-conjugating enzyme/RWD-like	IPR016135	-	-
Sma3	Zinc finger, RING-type, conserved site	IPR017907	-	-
Sma3	Tubulin, conserved site	IPR017975	-	-
Sma3	Aldo/keto reductase, conserved site	IPR018170	-	-
Sma3	EF-Hand 1, calcium-binding site	IPR018247	-	-
Sma3	Rubredoxin, iron-binding site	IPR018527	-	-
Sma3	Zinc finger, C3HC4 RING-type	IPR018957	-	-

Source	Species	ID	Description	Identity
ATG	Arabidoptis thaliana	AT2G35920.1	RNA helicase family protein chr2:15075674-15080506 FORWARD LENGTH=995	84%
RefSeq	Arabidopsis thaliana	NP_850255.1	helicase associated domain-containing protein [Arabidopsis thaliana]	84%
RefSeq	Populus trichocarpa	XP_002322777.1	predicted protein [Populus trichocarpa]	82%

Full-Lengther Next Prediction

Fln status: Internal

Fln database: sp_plants

Fln subject: P0CE10

Fln msg: Distance to subject end: 1104 aas, your sequence is shorter than subject: 142 - 1787

Fln protein: PNKFLLLPLHGSMPTVNQREIFQRPPNGMRKIILATNIAETSITIDDVVFVVDCGKAKETSYDALNKLACLTPSWISKASAHQRRGRAGRVQPGVCYHLYPKIIYDAMPLYQLPEILRTPLQELCLQIKSLQFGSISAFLSK

Protein Length: 143

Fln nts: TCCAAACAAATTCTTGTTGTTGCCATTACATGGGTCCATGCCTACAGTAAATCAGCGAGAGATATTTCAGCGACCGCCTAATGGGATGAGGAAAATCATACTTGCTACCAATATTGCGGAGACAAGTATCACAATAGACGATGTTGTTTTTGTAGTTGATTGCGGGAAAGCAAAAGAAACAAGCTATGATGCTTTAAACAAGCTTGCTTGTCTCACCCCCTCCTGGATCTCAAAGGCATCGGCTCATCAGAGGCGAGGACGAGCTGGACGTGTTCAACCTGGAGTTTGCTATCACCTATATCCAAAGATCATCTATGATGCCATGCCTCTATATCAGTTGCCGGAAATTCTTCGGACACCATTGCAAGAACTTTGCCTACAAATCAAAAGTCTGCAATTTGGAAGTATTTCTGCCTTCTTATCTAAA

Fln Alignment:

AllPine_a_c41490___LLLPLHGSMPTVNQREIFQRPPNGMRKIILATNIAETSITIDDVVFVVDCGKAKETSYDALNKLACLTPSWISKASAHQRRGRAGRVQPGVCYHLYPKIIYDAMPLYQLPEILRTPLQELCLQIKSLQFGSISAF
P0CE10________________IALPLHGKLSFEEQFMVFQNYP-GRRKVIFATNIAETSLTIPGVKYVIDSGMVKESKYEPRTGMSILKVCQVSQSSARQRAGRAGRTEPGRCYRLYSKTDFDSMNLNQEPEIRRVHLGVALLRMLALGIDNIAAF

Back

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain