UniGene Name: sp_v3.0_unigene107817
Length: 165 nt
![]() |
---|
>sp_v3.0_unigene107817
G |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | receptor-like kinase SYMRK [Lotus japonicus] | - | - | 2.0e-13 | 60% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 58% |
Sma3 | Kinase, putative | - | - | 4.428e-13 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Non-specific protein-tyrosine kinase. | EC:2.7.10.2 | - | 1.617e-07 | - |
Source | Gene names |
---|---|
Sma3 | At2g39360; At3g46290; At5g38990; At5g39000; At5g59700; CR4; Cr4; F12M12.260; F18L15.10; GSVIVT00019576001; GSVIVT00024420001; GSVIVT00033858001; GSVIVT00037712001; GSVIVT00038043001; GSVIVT00038045001; GSVIVT00038046001; LOC_Os03g17300; LOC_Os03g43670; Mp |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
Sma3 | protein serine/threonine kinase activity | GO:0004674 | Molecular Function | 0.0 | - |
Sma3 | protein tyrosine kinase activity | GO:0004713 | Molecular Function | 0.0 | - |
Sma3 | receptor activity | GO:0004872 | Molecular Function | 0.0 | - |
Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | protein phosphorylation | GO:0006468 | Biological Process | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT5G48740.1 | Leucine-rich repeat protein kinase family protein chr5:19765324-19769314 REVERSE LENGTH=895 | 3.0e-17 | 58% |
RefSeq | Arabidopsis thaliana | NP_199685.2 | putative LRR receptor-like serine/threonine-protein kinase [Arabidopsis thaliana] | 4.0e-17 | 58% |
RefSeq | Populus trichocarpa | XP_002301786.1 | predicted protein [Populus trichocarpa] | 5.0e-20 | 61% |
![]() |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: D5ACW2
Fln msg: Distance to subject end: 65 aas, your sequence is shorter than subject: 55 - 360
Fln protein:
G
Protein Length:
56
Fln nts:
G
Fln Alignment:
AllPine_a_c40310___GYLDPEYYNTQMLSEKSDVYSFGVVLLEILCGRKPIDLTVAEEDVNIIRWVTPYL
D5ACW2________________GYHAPEYAMTGQLSQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWATPRL
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain