UniGene Name: sp_v3.0_unigene107736
Length: 246 nt
![]() |
---|
>sp_v3.0_unigene107736
G |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Protein binding protein, putative n=1 Tax=Ricinus communis RepID=B9SVA9_RICCO | - | - | 8.0e-16 | 86% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 93% |
Sma3 | Protein binding protein, putative | - | - | 2.099e-06 | - |
Source | Gene names |
---|---|
Sma3 | At1g08050; At2g38970; At3g54780; At5g60710; GSVIVT00013411001; GSVIVT00018177001; GSVIVT00024560001; GSVIVT00035545001; LOC_Os03g04890; LOC_Os10g32740; OJ1111_C07.20; OJ1212_C01.33; OJ1372_D06.16; OSJNBa0049O12.7; OSJNBa0071K18.2; Os02g0619600; Os02g08067 |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
Sma3 | protein serine/threonine kinase activity | GO:0004674 | Molecular Function | 0.0 | - |
Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | zinc ion binding | GO:0008270 | Molecular Function | 0.0 | - |
Sma3 | protein phosphorylation | GO:0006468 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Ornithine/DAP/Arg decarboxylase | IPR000183 | - | 0.0 | - |
Sma3 | Protein kinase, catalytic domain | IPR000719 | - | 0.0 | - |
Sma3 | Zinc finger, RING-type | IPR001841 | - | 0.0 | - |
Sma3 | von Willebrand factor, type A | IPR002035 | - | 0.0 | - |
Sma3 | Immunoglobulin/major histocompatibility complex, conserved site | IPR003006 | - | 0.0 | - |
Sma3 | Zinc finger, C2H2 | IPR007087 | - | 0.0 | - |
Sma3 | Serine/threonine-protein kinase, active site | IPR008271 | - | 0.0 | - |
Sma3 | Zinc finger, C2H2-like | IPR015880 | - | 0.0 | - |
Sma3 | Protein kinase, ATP binding site | IPR017441 | - | 0.0 | - |
Sma3 | IPR017442 | - | 0.0 | - | |
Sma3 | EF-Hand 1, calcium-binding site | IPR018247 | - | 0.0 | - |
Sma3 | Zinc finger, C3HC4 RING-type | IPR018957 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT5G60710.1 | Zinc finger (C3HC4-type RING finger) family protein chr5:24410953-24414849 REVERSE LENGTH=704 | 7.0e-20 | 83% |
RefSeq | Arabidopsis thaliana | NP_200879.1 | C3H4 type zinc finger protein [Arabidopsis thaliana] | 9.0e-20 | 83% |
RefSeq | Populus trichocarpa | XP_002311085.1 | predicted protein [Populus trichocarpa] | 6.0e-18 | 76% |
![]() |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: C0PS55
Fln msg: Unexpected stop codon in the beginning of your sequence, Distance to subject end: 667 aas, your sequence is shorter than subject: 81 - 829
Fln protein:
L
Protein Length:
82
Fln nts:
G
Fln Alignment:
AllPine_a_c40180___GCCAICLEAMKPGYGHAIFTAECSHSFHFPCITSNVRHGNLICPV
C0PS55________________GCCAICLETMKPGHGHAIFTAECSHSFHFPCIASNVRHGNLICPV
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain