UniGene Name: sp_v3.0_unigene107559
Length: 234 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
UniGene Fasta (sense)
|
|---|
| >sp_v3.0_unigene107559
A |
Ace file of the UniGene sp_v3.0_unigene107559 (antisense)
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | phosphatidic acid phosphatase alpha [Vigna unguiculata] gb|ABN13873.1| phosphatidic acid phosphatase alpha [Vigna unguiculata] | - | - | 4.0e-21 | 61% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 70% |
| Sma3 | Phosphatidic acid phosphatase, putative | - | - | 3.125e-12 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Hydrolases, Acting on ester bonds, Phosphoric monoester hydrolases. | EC:3.1.3.- | - | 1.25e-11 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Fructose and mannose metabolism | 00051 | 1.25e-11 | % | |
| Sma3 | Ascorbate and aldarate metabolism | 00053 | 1.25e-11 | % | |
| Sma3 | Lipopolysaccharide biosynthesis | 00540 | 1.25e-11 | % | |
| Sma3 | Ether lipid metabolism | 00565 | 1.25e-11 | % | |
| Sma3 | Sphingolipid metabolism | 00600 | 1.25e-11 | % | |
| Sma3 | Thiamine metabolism | 00730 | 1.25e-11 | % | |
| Sma3 | Riboflavin metabolism | 00740 | 1.25e-11 | % | |
| Sma3 | Nicotinate and nicotinamide metabolism | 00760 | 1.25e-11 | % | |
| Sma3 | Metabolic pathways | 01100 | 1.25e-11 | % | |
| Sma3 | Biosynthesis of secondary metabolites | 01110 | 1.25e-11 | % | |
| Sma3 | Phosphatidate phosphatase. | EC:3.1.3.4 | - | 1.25e-11 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Glycerolipid metabolism | 00561 | 1.25e-11 | % | |
| Sma3 | Glycerophospholipid metabolism | 00564 | 1.25e-11 | % | |
| Sma3 | Ether lipid metabolism | 00565 | 1.25e-11 | % | |
| Sma3 | Sphingolipid metabolism | 00600 | 1.25e-11 | % | |
| Sma3 | Metabolic pathways | 01100 | 1.25e-11 | % |
| Source | Gene names |
|---|---|
| Sma3 | At1g15080; At2g01180; At3g02600; At3g18220; F10A8.6; F16B3.23; F9L1.2; GSVIVT00017742001; GSVIVT00030412001; GSVIVT00030413001; GSVIVT00038277001; LPP1; LPP2; LPP3; OSJNBa0019B22.8-1; OSJNBa0019B22.8-2; OSJNBa0092O08.28-1; OSJNBa0092O08.28-2; OSJNBb0063G0 |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
| Sma3 | integral to plasma membrane | GO:0005887 | Cellular Component | 0.0 | - |
| Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
| Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
| Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
| Sma3 | catalytic activity | GO:0003824 | Molecular Function | 0.0 | - |
| Sma3 | peroxidase activity | GO:0004601 | Molecular Function | 0.0 | - |
| Sma3 | phosphatidate phosphatase activity | GO:0008195 | Molecular Function | 0.0 | - |
| Sma3 | hydrolase activity | GO:0016787 | Molecular Function | 0.0 | - |
| Sma3 | plant-type hypersensitive response | GO:0009626 | Biological Process | 0.0 | - |
| Sma3 | abscisic acid mediated signaling pathway | GO:0009738 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Phosphatidic acid phosphatase type 2/haloperoxidase | IPR000326 | - | 0.0 | - |
| Sma3 | Beta tubulin, autoregulation binding site | IPR013838 | - | 0.0 | - |
| Sma3 | Phosphatidic acid phosphatase/chloroperoxidase, N-terminal | IPR016118 | - | 0.0 | - |
| Sma3 | Bromoperoxidase/chloroperoxidase, C-terminal | IPR016119 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT1G15080.1 | ATPAP2, ATLPP2, LPP2 lipid phosphate phosphatase 2 chr1:5188080-5189476 FORWARD LENGTH=290 | 1.0e-27 | 70% |
| RefSeq | Arabidopsis thaliana | NP_172961.1 | Lipid phosphate phosphatase 2 [Arabidopsis thaliana] | 1.0e-27 | 70% |
| RefSeq | Populus trichocarpa | XP_002315917.1 | predicted protein [Populus trichocarpa] | 1.0e-27 | 71% |
Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: A9NWR3
Fln msg: Distance to subject end: 90 aas, your sequence is shorter than subject: 78 - 338
Fln protein:
T
Protein Length:
79
Fln nts:
A
Fln Alignment:
AllPine_a_c39878___TSWCFAGLGFVSLYLAGKIRLFDRKGHVSKLVIVFSPLAVASFVGLSRVNDYKHNWQDVFXXXXXXXXXXXLCYRQFF
A9NWR3________________TSWSFAGLGYLSLYLAAKINIFDRQGHASKLCIIFFPLLAAALIGISRVDDYWHHWQDVFAGGLIGLTIATLCYRQFF

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
UniGene Fasta (sense)