UniGene Name: sp_v3.0_unigene107516
Length: 234 nt
UniGene Fasta |
---|
>sp_v3.0_unigene107516
T |
Ace file of the UniGene sp_v3.0_unigene107516 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | myb-related transcription factor [Datura metel] | - | - | 5.0e-22 | 86% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 80% |
Sma3 | MYB transcription factor | - | - | 1.439e-24 | - |
Source | Gene names |
---|---|
Sma3 | 117M18_17; 46C02.19; AT4g22680; At1g06180; At1g34670; At1g56160; At2g31180; At2g47460; At3g01140; At3g02940; At3g23250; At3g61250; At3g62610; At4g21440; At4g22680; At5g10280; At5g15310; At5g16600; At5g16770; At5g49330; AtMYB15; B1053A04.9; B1215B07.15; Dc |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
Sma3 | DNA binding | GO:0003677 | Molecular Function | 0.0 | - |
Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
Sma3 | transcription activator activity | GO:0016563 | Molecular Function | 0.0 | - |
Sma3 | cell morphogenesis | GO:0000902 | Biological Process | 0.0 | - |
Sma3 | regulation of transcription, DNA-dependent | GO:0006355 | Biological Process | 0.0 | - |
Sma3 | response to stress | GO:0006950 | Biological Process | 0.0 | - |
Sma3 | response to salt stress | GO:0009651 | Biological Process | 0.0 | - |
Sma3 | response to ethylene stimulus | GO:0009723 | Biological Process | 0.0 | - |
Sma3 | response to auxin stimulus | GO:0009733 | Biological Process | 0.0 | - |
Sma3 | response to abscisic acid stimulus | GO:0009737 | Biological Process | 0.0 | - |
Sma3 | response to gibberellin stimulus | GO:0009739 | Biological Process | 0.0 | - |
Sma3 | response to salicylic acid stimulus | GO:0009751 | Biological Process | 0.0 | - |
Sma3 | response to jasmonic acid stimulus | GO:0009753 | Biological Process | 0.0 | - |
Sma3 | flavonoid biosynthetic process | GO:0009813 | Biological Process | 0.0 | - |
Sma3 | induced systemic resistance, ethylene mediated signaling pathway | GO:0009866 | Biological Process | 0.0 | - |
Sma3 | response to chitin | GO:0010200 | Biological Process | 0.0 | - |
Sma3 | GO:0045449 | Biological Process | 0.0 | - | |
Sma3 | response to cadmium ion | GO:0046686 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Ketose-bisphosphate aldolase, class-II | IPR000771 | - | 0.0 | - |
Sma3 | SANT/Myb domain | IPR001005 | - | 0.0 | - |
Sma3 | Myb-related protein P, C-terminal | IPR010588 | - | 0.0 | - |
Sma3 | IPR012287 | - | 0.0 | - | |
Sma3 | IPR014778 | - | 0.0 | - | |
Sma3 | Myb transcription factor | IPR015495 | - | 0.0 | - |
Sma3 | Myb-like domain | IPR017877 | - | 0.0 | - |
Sma3 | Myb domain, DNA-binding | IPR017930 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT3G61250.1 | AtMYB17, MYB17 myb domain protein 17 chr3:22671306-22672551 FORWARD LENGTH=299 | 6.0e-27 | 78% |
RefSeq | Arabidopsis thaliana | NP_191684.1 | myb domain protein 17 [Arabidopsis thaliana] | 8.0e-27 | 78% |
RefSeq | Populus trichocarpa | XP_002301350.1 | predicted protein [Populus trichocarpa] | 2.0e-27 | 80% |
Full-Lengther Next Prediction |
---|
Fln status: N-terminus
Fln database: coniferopsida.fasta
Fln subject: A9P0V4
Fln msg: Distance to subject end: 277 aas, your sequence is shorter than subject: 52 - 330
Fln protein:
M
Protein Length:
53
Fln nts:
T
Fln Alignment:
AllPine_a_c39808___MGRAPCCEKTGLKRGPWTPEEDKILINYIQKNGHGSWRALPKLAGLLRCGKS
A9P0V4________________MGRAPCCEKVGLKKGPWTPEEDQKLVAYIQEHGHGSWRALPQKAGLLRCGKS
SNPs (tot: 1) |
---|
Position | A % | C % | G % | T % | Probability |
---|---|---|---|---|---|
121 | 66 | 33 | 0.997471 |
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain