|
||||||
|
UniGene Name: sp_v3.0_unigene107464
Length: 178 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene107464
C |
|
Ace file of the UniGene sp_v3.0_unigene107464
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Wall-associated receptor kinase-like 14 n=2 Tax=Arabidopsis RepID=WAKLO_ARATH | - | - | 2.0e-17 | 70% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 55% |
| Sma3 | Kinase, putative | - | - | 9.598e-10 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Transferases, Transferring phosphorous-containing groups, Protein-serine/threonine kinases. | EC:2.7.11.- | - | 2.903e-12 | - |
| Sma3 | EC:2.7.11.3- | - | 2.351e-06 | - |
| Source | Gene names |
|---|---|
| Sma3 | AT5G48740; At2g23450; At3g53840; At4g31100; At4g31110; At5g02070; At5g66790; F26B6.10; F5K20_140; F6E21.20; F6E21.30; GSVIVT00000553001; GSVIVT00001787001; GSVIVT00001788001; GSVIVT00005293001; GSVIVT00010057001; GSVIVT00011185001; GSVIVT00013473001; GSVI |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
| Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
| Sma3 | nucleic acid binding | GO:0003676 | Molecular Function | 0.0 | - |
| Sma3 | peptidyl-prolyl cis-trans isomerase activity | GO:0003755 | Molecular Function | 0.0 | - |
| Sma3 | protein serine/threonine kinase activity | GO:0004674 | Molecular Function | 0.0 | - |
| Sma3 | protein tyrosine kinase activity | GO:0004713 | Molecular Function | 0.0 | - |
| Sma3 | receptor activity | GO:0004872 | Molecular Function | 0.0 | - |
| Sma3 | calcium ion binding | GO:0005509 | Molecular Function | 0.0 | - |
| Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
| Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
| Sma3 | protein folding | GO:0006457 | Biological Process | 0.0 | - |
| Sma3 | protein phosphorylation | GO:0006468 | Biological Process | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT2G23450.2 | Protein kinase superfamily protein chr2:9988926-9991244 REVERSE LENGTH=708 | 6.0e-23 | 70% |
| RefSeq | Arabidopsis thaliana | NP_565552.1 | wall-associated receptor kinase-like 14 [Arabidopsis thaliana] | 8.0e-23 | 70% |
| RefSeq | Populus trichocarpa | XP_002327085.1 | predicted protein [Populus trichocarpa] | 7.0e-21 | 67% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: C0PRI9
Fln msg: Distance to subject end: 236 aas, your sequence is shorter than subject: 59 - 656
Fln protein:
I
Protein Length:
60
Fln nts:
C
Fln Alignment:
AllPine_a_c39722___IATDASEALAYLHSTLNPPIYHRDVKSCNILLDMDFNCKVADFGLSRLVLSDGSHIST
C0PRI9________________IAIGAARGLAYLHEDCYPKIIHRDIKASNILLDSNFEAKVADFGLAKLASEDFTHVST
| SNPs (tot: 4) |
|---|
| Position | A % | C % | G % | T % | Probability |
|---|---|---|---|---|---|
| 74 | 33 | 66 | 0.997452 | ||
| 76 | 66 | 33 | 0.997452 | ||
| 77 | 66 | 33 | 0.997452 | ||
| 78 | 66 | 33 | 0.997452 |
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
