|
||||||
|
UniGene Name: sp_v3.0_unigene107246
Length: 213 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
 UniGene Fasta (sense)
|
|---|
| >sp_v3.0_unigene107246
A |
|
Ace file of the UniGene sp_v3.0_unigene107246 (antisense)
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | R2R3-MYB transcription factor MYB7 [Pinus taeda] | - | - | 3.0e-24 | 89% |
| FL-Next | tr=R2R3-MYB transcription factor MYB7; Pinus taeda (Loblolly pine). | - | - | 0.0 | 89% |
| Sma3 | MYB transcription factor TaMYB1 | - | - | 5.278e-14 | - |
| Source | Gene names |
|---|---|
| Sma3 | AT4g37260; At2g23290; At2g39880; At3g09230; At3g50060; At3g55730; At4g37260; At5g67300; AtMYB77; B19; C7A10.100; CHLREDRAFT_103798; CHLREDRAFT_106655; CHLREDRAFT_116056; CHLREDRAFT_116461; F1I16_140; F3A4.140; F3L24.10; GSVIVT00014754001; GSVIVT0001488700 |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
| Sma3 | cytoplasm | GO:0005737 | Cellular Component | 0.0 | - |
| Sma3 | DNA binding | GO:0003677 | Molecular Function | 0.0 | - |
| Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
| Sma3 | regulation of transcription, DNA-dependent | GO:0006355 | Biological Process | 0.0 | - |
| Sma3 | response to water deprivation | GO:0009414 | Biological Process | 0.0 | - |
| Sma3 | response to salt stress | GO:0009651 | Biological Process | 0.0 | - |
| Sma3 | response to ethylene stimulus | GO:0009723 | Biological Process | 0.0 | - |
| Sma3 | response to auxin stimulus | GO:0009733 | Biological Process | 0.0 | - |
| Sma3 | response to abscisic acid stimulus | GO:0009737 | Biological Process | 0.0 | - |
| Sma3 | abscisic acid mediated signaling pathway | GO:0009738 | Biological Process | 0.0 | - |
| Sma3 | response to gibberellin stimulus | GO:0009739 | Biological Process | 0.0 | - |
| Sma3 | response to salicylic acid stimulus | GO:0009751 | Biological Process | 0.0 | - |
| Sma3 | response to jasmonic acid stimulus | GO:0009753 | Biological Process | 0.0 | - |
| Sma3 | response to chitin | GO:0010200 | Biological Process | 0.0 | - |
| Sma3 | GO:0045449 | Biological Process | 0.0 | - | |
| Sma3 | response to cadmium ion | GO:0046686 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | ATPase, F1/V1/A1 complex, alpha/beta subunit, nucleotide-binding domain | IPR000194 | - | 0.0 | - |
| Sma3 | SANT/Myb domain | IPR001005 | - | 0.0 | - |
| Sma3 | IPR012287 | - | 0.0 | - | |
| Sma3 | IPR014778 | - | 0.0 | - | |
| Sma3 | Myb transcription factor | IPR015495 | - | 0.0 | - |
| Sma3 | Myb domain, DNA-binding | IPR017930 | - | 0.0 | - |
| Sma3 | EF-Hand 1, calcium-binding site | IPR018247 | - | 0.0 | - |
| Sma3 | Chaperonin Cpn60, conserved site | IPR018370 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT4G37260.1 | MYB73, ATMYB73 myb domain protein 73 chr4:17540602-17541564 FORWARD LENGTH=320 | 1.0e-29 | 83% |
| RefSeq | Arabidopsis thaliana | NP_195443.1 | myb domain protein 73 [Arabidopsis thaliana] | 1.0e-29 | 83% |
| RefSeq | Populus trichocarpa | XP_002302428.1 | predicted protein [Populus trichocarpa] | 3.0e-30 | 85% |
| Full-Lengther Next Prediction |
|---|
Fln status: Putative N-terminus
Fln database: coniferopsida.fasta
Fln subject: Q27IP0
Fln msg: Distance to subject end: 305 aas, W2: There is no M at the beginning, your sequence is shorter than subject: 70 - 374
Fln protein:
K
Protein Length:
71
Fln nts:
A
Fln Alignment:
AllPine_a_c39391___RIKGPWSPEEDAALQKLVEKLGPRNWSLISKGIPGRSGKSCRLRWCNQLSPQVQH
Q27IP0________________RIKGPWSPEEDASLQRLVQKYGPRNWTLISKGIPGRSGKSCRLRWCNQLSPQVEH
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
