UniGene Name: sp_v3.0_unigene107232
Length: 212 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
UniGene Fasta (sense) |
---|
>sp_v3.0_unigene107232
A |
Ace file of the UniGene sp_v3.0_unigene107232 (antisense) |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | wall-associated receptor kinase-like 14 [Arabidopsis thaliana] ref|NP_850041.1| wall-associated receptor kinase-like 14 [Arabidopsis thaliana] sp|Q8RY67.2|WAKLO_ARATH RecName: Full=Wall-associated receptor kinase-like 14; Flags: Precursor gb|AAC23760.2| p | - | - | 7.0e-26 | 75% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 52% |
Sma3 | Putative wall-associated kinase 4 | - | - | 3.095e-13 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Mitogen-activated protein kinase kinase kinase. | EC:2.7.11.25 | - | 2.435e-09 | - |
Source | Gene names |
---|---|
Sma3 | AT4G28490; At1g49270; At2g23450; At4g28490; At5g02070; At5g66790; B1148D12.10; F13F21.28; F21O9.180; F26B6.10; GSVIVT00000553001; GSVIVT00005293001; GSVIVT00005799001; GSVIVT00005801001; GSVIVT00005812001; GSVIVT00010057001; GSVIVT00011185001; GSVIVT00013 |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
Sma3 | nucleic acid binding | GO:0003676 | Molecular Function | 0.0 | - |
Sma3 | peptidyl-prolyl cis-trans isomerase activity | GO:0003755 | Molecular Function | 0.0 | - |
Sma3 | protein serine/threonine kinase activity | GO:0004674 | Molecular Function | 0.0 | - |
Sma3 | protein tyrosine kinase activity | GO:0004713 | Molecular Function | 0.0 | - |
Sma3 | receptor activity | GO:0004872 | Molecular Function | 0.0 | - |
Sma3 | calcium ion binding | GO:0005509 | Molecular Function | 0.0 | - |
Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | protein folding | GO:0006457 | Biological Process | 0.0 | - |
Sma3 | protein phosphorylation | GO:0006468 | Biological Process | 0.0 | - |
Sma3 | protein autophosphorylation | GO:0046777 | Biological Process | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT2G23450.2 | Protein kinase superfamily protein chr2:9988926-9991244 REVERSE LENGTH=708 | 2.0e-32 | 75% |
RefSeq | Arabidopsis thaliana | NP_565552.1 | wall-associated receptor kinase-like 14 [Arabidopsis thaliana] | 2.0e-32 | 75% |
RefSeq | Populus trichocarpa | XP_002327085.1 | predicted protein [Populus trichocarpa] | 2.0e-32 | 78% |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: D5ADV0
Fln msg: Distance to subject end: 163 aas, your sequence is shorter than subject: 70 - 271
Fln protein:
C
Protein Length:
71
Fln nts:
A
Fln Alignment:
AllPine_a_c39372___YEFVPNGTLAQHLQRERGEGLNWPTRISIATETAKAIAYLHSTMTPPIYHRDIKSSNILLDYDFNAKVA
D5ADV0________________YEFMENGNLSQHLRGSGMEPLSWPARVQIALEIAKGLEYIHEHTVPAYIHRDIKSANILIDKNYHAKVA
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain