UniGene Name: sp_v3.0_unigene107200
Length: 233 nt
UniGene Fasta |
---|
>sp_v3.0_unigene107200
G |
Ace file of the UniGene sp_v3.0_unigene107200 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Unassigned protein | - | - | 0.0 | - |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 70% |
Sma3 | Pentatricopeptide repeat-containing protein, putative | - | - | 1.64e-12 | - |
Source | Gene names |
---|---|
Sma3 | At1g06140; At1g20230; At1g28690; At2g01510; At2g13600; At2g22070; At3g11460; At3g26782; At4g01030; At4g02750; At4g19191; At4g21300; At4g33990; At5g40410; At5g44230; At5g66520; B1032F05.19; B1358B12.23; EMB2758; F17I5.180; F1K23.11; F24K9.13; F2I9.13; F3I3 |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | intracellular | GO:0005622 | Cellular Component | 0.0 | - |
Sma3 | mitochondrion | GO:0005739 | Cellular Component | 0.0 | - |
Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
Sma3 | aspartic-type endopeptidase activity | GO:0004190 | Molecular Function | 0.0 | - |
Sma3 | ubiquitin thiolesterase activity | GO:0004221 | Molecular Function | 0.0 | - |
Sma3 | binding | GO:0005488 | Molecular Function | 0.0 | - |
Sma3 | deaminase activity | GO:0019239 | Molecular Function | 0.0 | - |
Sma3 | proteolysis | GO:0006508 | Biological Process | 0.0 | - |
Sma3 | ubiquitin-dependent protein catabolic process | GO:0006511 | Biological Process | 0.0 | - |
Sma3 | purine ribonucleoside monophosphate biosynthetic process | GO:0009168 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Armadillo | IPR000225 | - | 0.0 | - |
Sma3 | Adenosine/AMP deaminase domain | IPR001365 | - | 0.0 | - |
Sma3 | Peptidase C12, ubiquitin carboxyl-terminal hydrolase 1 | IPR001578 | - | 0.0 | - |
Sma3 | Pentatricopeptide repeat | IPR002885 | - | 0.0 | - |
Sma3 | Immunoglobulin/major histocompatibility complex, conserved site | IPR003006 | - | 0.0 | - |
Sma3 | Domain of unknown function DUF221 | IPR003864 | - | 0.0 | - |
Sma3 | Armadillo-like helical | IPR011989 | - | 0.0 | - |
Sma3 | Tetratricopeptide-like helical | IPR011990 | - | 0.0 | - |
Sma3 | Thioredoxin, conserved site | IPR017937 | - | 0.0 | - |
Sma3 | Asp/Glu racemase, active site | IPR018187 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT3G11460.1 | Pentatricopeptide repeat (PPR) superfamily protein chr3:3608250-3610121 FORWARD LENGTH=623 | 2.0e-29 | 59% |
RefSeq | Arabidopsis thaliana | NP_187753.1 | pentatricopeptide repeat-containing protein [Arabidopsis thaliana] | 2.0e-29 | 59% |
RefSeq | Populus trichocarpa | XP_002302824.1 | predicted protein [Populus trichocarpa] | 3.0e-32 | 66% |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: D5ADG9
Fln msg: Distance to subject end: 187 aas, your sequence is shorter than subject: 77 - 312
Fln protein:
S
Protein Length:
78
Fln nts:
G
Fln Alignment:
AllPine_a_c39330___SACSHAGLVDDGWRYLDSMSQDYCITPGLEHYACMVDILGRAGHLDEAQDFVQNMPLEPDSGVWGALLGACRIHCNI
D5ADG9________________SACSHAGLVDEGWKCYNCMTLDYAITPTVEHYACMVDLLGRAGHLNEAWDFIEKMPIEPGASVWGAFLGSCRIHCNI
SNPs (tot: 2) |
---|
Position | A % | C % | G % | T % | Probability |
---|---|---|---|---|---|
209 | 33 | 66 | 0.997464 | ||
213 | 66 | 33 | 0.997464 |
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain