SustainPineDB

All assemblies
Assembly info
Unigenes
SNPs
SSRs
Descriptions
GOs
ECs
KEGGs
InterPros
miRNAs

Assembly Name: SustainPine v3.0

UniGene Name: sp_v3.0_unigene106933

Length: 382 nt

UniGene Fasta

>sp_v3.0_unigene106933
AGGCAGGGCAACAGAGCAGTTATGAATTAGCGCTCTCTCAGCCGCAAGCTCAATCTTCACCTCCACCAGGAATTGTGGCAGCACCTGCACCTGCACCCGCACCCGCACGCCCTCGAGTAAGGGCCAGGCGTGGTCAAGCGACAGATCCTCATAGTATTGCCGAAAGACAACGAAGAGAAAGAATTGCAGAAAGAATGAAGGCATTACAGGAGCTGGTTCCCAACTGTAGTAAGACCGACAAGGCAGCTATGCTGGACGAAATAATTGAGTACGTAAAGTTTCTGCAGTTGCAAGTGAAGGTCCTAAGCATGAGTAGACTTGGTGGCGCAGGAGCAGCTGGTCAGGCTATAGCAGATATCTCTGCAGATGCTTCAAGCAGCAT

Ace file of the UniGene sp_v3.0_unigene106933

If you push the Download ace button, you will download an ace file of this UniGene.

To watch this ACE file you will need an ACE viewer program as Tablet:

Go to the Tablet ACE viewer Web

Annotations

Source	Descriptions	Term	Type	e value	Identity
AutoFact	bHLH transcription factor PTF1-like [Oryza sativa Japonica Group]	-	-	2.0e-14	70%
FL-Next	tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis).	-	-	0.0	69%
Sma3	BHLH transcription factor	-	-	1.252e-19	-

Source	Gene names
Sma3	AP22.3; AT1G68920; AT2G43010; AT3G59060; AT4G02590; At1g03040; At1g09530; At1g10120; At1g26260; At1g59640; At1g68920; At2g18300; At2g20180; At2g24260; At2g43010; At3g07340; At3g23690; At3g59060; At4g02590; At4g28811; At4g30980; At4g34530; At4g36540; At5g4

Source	GOs	Term	Type	Identity
Sma3	nucleus	GO:0005634	Cellular Component	-
Sma3	plastid	GO:0009536	Cellular Component	-
Sma3	DNA binding	GO:0003677	Molecular Function	-
Sma3	sequence-specific DNA binding transcription factor activity	GO:0003700	Molecular Function	-
Sma3	protein binding	GO:0005515	Molecular Function	-
Sma3	phytochrome binding	GO:0010313	Molecular Function	-
Sma3	transcription regulator activity	GO:0030528	Molecular Function	-
Sma3	identical protein binding	GO:0042802	Molecular Function	-
Sma3	regulation of transcription, DNA-dependent	GO:0006355	Biological Process	-
Sma3	protein modification process	GO:0006464	Biological Process	-
Sma3	heme biosynthetic process	GO:0006783	Biological Process	-
Sma3	multicellular organismal development	GO:0007275	Biological Process	-
Sma3	double fertilization forming a zygote and endosperm	GO:0009567	Biological Process	-
Sma3	red, far-red light phototransduction	GO:0009585	Biological Process	-
Sma3	ethylene biosynthetic process	GO:0009693	Biological Process	-
Sma3	de-etiolation	GO:0009704	Biological Process	-
Sma3	response to cytokinin stimulus	GO:0009735	Biological Process	-
Sma3	response to gibberellin stimulus	GO:0009739	Biological Process	-
Sma3	gibberellic acid mediated signaling pathway	GO:0009740	Biological Process	-
Sma3	positive regulation of flower development	GO:0009911	Biological Process	-
Sma3	negative gravitropism	GO:0009959	Biological Process	-
Sma3	red or far-red light signaling pathway	GO:0010017	Biological Process	-
Sma3	negative regulation of photomorphogenesis	GO:0010100	Biological Process	-
Sma3	red light signaling pathway	GO:0010161	Biological Process	-
Sma3	negative regulation of seed germination	GO:0010187	Biological Process	-
Sma3	chlorophyll biosynthetic process	GO:0015995	Biological Process	-
Sma3	positive regulation of anthocyanin metabolic process	GO:0031539	Biological Process	-
Sma3		GO:0045449	Biological Process	-
Sma3	petal morphogenesis	GO:0048446	Biological Process	-

Source	InterPros	Term	Type	Identity
Sma3	Peptidase S8/S53, subtilisin/kexin/sedolisin	IPR000209	-	-
Sma3	Ubiquitin	IPR000626	-	-
Sma3		IPR001092	-	-
Sma3	F-box domain, cyclin-like	IPR001810	-	-
Sma3	Pentatricopeptide repeat	IPR002885	-	-
Sma3	DNA-directed RNA polymerase, subunit 2, domain 6	IPR007120	-	-
Sma3	Helix-loop-helix DNA-binding	IPR011598	-	-
Sma3	RNA polymerase Rpb2, OB-fold	IPR014724	-	-
Sma3	DNA-directed RNA polymerase, subunit 2	IPR015712	-	-
Sma3	Peptidase S26A, signal peptidase I, serine active site	IPR019756	-	-
Sma3	WD40 repeat, conserved site	IPR019775	-	-

Source	Species	ID	Description	e value	Identity
ATG	Arabidoptis thaliana	AT5G58010.1	LRL3 LJRHL1-like 3 chr5:23483670-23484889 REVERSE LENGTH=297	4.0e-19	90%
RefSeq	Arabidopsis thaliana	NP_200609.1	transcription factor bHLH82 [Arabidopsis thaliana]	6.0e-19	90%
RefSeq	Populus trichocarpa	XP_002325140.1	predicted protein [Populus trichocarpa]	1.0e-19	91%

Full-Lengther Next Prediction

Fln status: N-terminus

Fln database: coniferopsida.fasta

Fln subject: D5ABG4

Fln msg: Distance to subject end: 181 aas, your sequence is shorter than subject: 62 - 244

Fln protein: MKALQELVPNCSKTDKAAMLDEIIEYVKFLQLQVKVLSMSRLGGAGAAGQAIADISADASSS

Protein Length: 63

Fln nts: AGGCAGGGCAACAGAGCAGTTATGAATTAGCGCTCTCTCAGCCGCAAGCTCAATCTTCACCTCCACCAGGAATTGTGGCAGCACCTGCACCTGCACCCGCACCCGCACGCCCTCGAGTAAGGGCCAGGCGTGGTCAAGCGACAGATCCTCATAGTATTGCCGAAAGACAACGAAGAGAAAGAATTGCAGAAAGA_-_ATGAAGGCATTACAGGAGCTGGTTCCCAACTGTAGTAAGACCGACAAGGCAGCTATGCTGGACGAAATAATTGAGTACGTAAAGTTTCTGCAGTTGCAAGTGAAGGTCCTAAGCATGAGTAGACTTGGTGGCGCAGGAGCAGCTGGTCAGGCTATAGCAGATATCTCTGCAGATGCTTCAAGCAGCAT

Fln Alignment:

AllPine_a_c38956___MKALQELVPNCSKTDKAAMLDEIIEYVKFLQLQVKVLSM
D5ABG4________________MRALQELIPHCNKSDKASMLDEAIEYLKTLQLQVQIMSM

Back

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain