UniGene Name: sp_v3.0_unigene106776
Length: 245 nt
UniGene Fasta |
---|
>sp_v3.0_unigene106776
G |
Ace file of the UniGene sp_v3.0_unigene106776 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | aminodeoxychorismate synthase/glutamine amidotransferase [Solanum lycopersicum] | - | - | 4.0e-23 | 74% |
FL-Next | sp=Anthranilate synthase component II; Porphyra purpurea. Plastid; Chloroplast. | - | - | 0.0 | 37% |
Source | Gene names |
---|---|
Sma3 | ADC1; At2g28880; CHLREDRAFT_123116; GSVIVT00018205001; GSVIVT00018207001; OsI_24347; OsJ_22523; P0468G03.14; PABAS; PHYPADRAFT_190627; POPTRDRAFT_770528; RCOM_0228150; VITISV_025570; |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | anthranilate synthase activity | GO:0004049 | Molecular Function | 0.0 | - |
Sma3 | transferase activity | GO:0016740 | Molecular Function | 0.0 | - |
Sma3 | glutamine metabolic process | GO:0006541 | Biological Process | 0.0 | - |
Sma3 | biosynthetic process | GO:0009058 | Biological Process | 0.0 | - |
Sma3 | folic acid-containing compound biosynthetic process | GO:0009396 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | IPR000991 | - | 0.0 | - | |
Sma3 | IPR001317 | - | 0.0 | - | |
Sma3 | Ribonuclease A | IPR001427 | - | 0.0 | - |
Sma3 | Phosphotransferase system, HPr serine phosphorylation site | IPR002114 | - | 0.0 | - |
Sma3 | ADC synthase | IPR005801 | - | 0.0 | - |
Sma3 | Para-aminobenzoate synthase, component I | IPR005802 | - | 0.0 | - |
Sma3 | IPR006220 | - | 0.0 | - | |
Sma3 | Anthranilate synthase, glutamine amidotransferase | IPR006221 | - | 0.0 | - |
Sma3 | Anthranilate synthase component I, N-terminal | IPR006805 | - | 0.0 | - |
Sma3 | Tyrosine-protein kinase, active site | IPR008266 | - | 0.0 | - |
Sma3 | IPR011702 | - | 0.0 | - | |
Sma3 | Chorismate binding, C-terminal | IPR015890 | - | 0.0 | - |
Sma3 | Aldehyde dehydrogenase, conserved site | IPR016160 | - | 0.0 | - |
Sma3 | Glutamine amidotransferase type 1 | IPR017926 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT2G28880.1 | emb1997, ADCS para-aminobenzoate (PABA) synthase family protein chr2:12398937-12403108 REVERSE LENGTH=919 | 9.0e-23 | 66% |
RefSeq | Arabidopsis thaliana | NP_850127.1 | para-aminobenzoate synthetase [Arabidopsis thaliana] | 1.0e-22 | 66% |
RefSeq | Populus trichocarpa | XP_002315300.1 | p-aminobenzoate synthase [Populus trichocarpa] | 2.0e-24 | 69% |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: sp_plants
Fln subject: P51362
Fln msg: Distance to subject end: 20 aas, your sequence is shorter than subject: 81 - 189
Fln protein:
E
Protein Length:
82
Fln nts:
G
Fln Alignment:
AllPine_a_c38724___VIHAPEPVHGRLSEIEHTGCQLFNGIPSGAGSGFKVVRYHSLVLDAKTLPSDLIPIAWT
P51362________________IIKVPKIMHGKTSQIYHDREDLFINLPNP----FIATRYHSLIIDRANFPTNLAVTAWT
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain