|
||||||
|
UniGene Name: sp_v3.0_unigene106734
Length: 238 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene106734
G |
|
Ace file of the UniGene sp_v3.0_unigene106734
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Glutamate receptor (Fragment) n=2 Tax=Vitis vinifera RepID=D7SWB7_VITVI | - | - | 2.0e-09 | 54% |
| FL-Next | sp=Glutamate receptor 3.7; Arabidopsis thaliana (Mouse-ear cress). | - | - | 0.0 | 58% |
| Sma3 | Glutamate receptor 3 plant, putative | - | - | 6.391e-17 | - |
| Source | Gene names |
|---|---|
| Sma3 | ACL1; At1g05200; At1g42540; At2g17260; At2g32390; At2g32400; At3g51480; At4g35290; F23E12.150; F26O13.120; GLR2; GLR3.1; GLR3.2; GLR3.3; GLR3.4; GLR3.5; GLR3.6; GLR3.7; GLR4; GLR5; GLR6; GLUR2; GLUR3; GSVIVT00002906001; GSVIVT00019331001; GSVIVT0002603300 |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
| Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
| Sma3 | G-protein coupled receptor activity | GO:0004930 | Molecular Function | 0.0 | - |
| Sma3 | G-protein coupled GABA receptor activity | GO:0004965 | Molecular Function | 0.0 | - |
| Sma3 | ionotropic glutamate receptor activity | GO:0004970 | Molecular Function | 0.0 | - |
| Sma3 | extracellular-glutamate-gated ion channel activity | GO:0005234 | Molecular Function | 0.0 | - |
| Sma3 | ion transport | GO:0006811 | Biological Process | 0.0 | - |
| Sma3 | G-protein coupled receptor signaling pathway | GO:0007186 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | GPCR, family 3 | IPR000337 | - | 0.0 | - |
| Sma3 | Ionotropic glutamate receptor | IPR001320 | - | 0.0 | - |
| Sma3 | Extracellular solute-binding protein, family 3 | IPR001638 | - | 0.0 | - |
| Sma3 | Extracellular ligand-binding receptor | IPR001828 | - | 0.0 | - |
| Sma3 | GPCR, family 3, gamma-aminobutyric acid receptor, type B | IPR002455 | - | 0.0 | - |
| Sma3 | Zinc finger, C2H2 | IPR007087 | - | 0.0 | - |
| Sma3 | IPR015683 | - | 0.0 | - | |
| Sma3 | Ionotropic glutamate receptor, plant | IPR017103 | - | 0.0 | - |
| Sma3 | HTH domain AraC-type, conserved site | IPR018062 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT2G32400.1 | GLR5, GLR3.7, ATGLR3.7 glutamate receptor 5 chr2:13752665-13756233 REVERSE LENGTH=921 | 3.0e-13 | 58% |
| RefSeq | Arabidopsis thaliana | NP_565744.1 | glutamate receptor 3.7 [Arabidopsis thaliana] | 3.0e-13 | 58% |
| RefSeq | Populus trichocarpa | XP_002306988.1 | glutamate-gated kainate-type ion channel receptor subunit GluR5, partial [Populus trichocarpa] | 4.0e-13 | 64% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: sp_plants
Fln subject: Q9SDQ4
Fln msg: Distance to subject end: 229 aas, your sequence is shorter than subject: 79 - 921
Fln protein:
A
Protein Length:
80
Fln nts:
G
Fln Alignment:
AllPine_a_c38667___TVFRAHREKVESNVVRTXXXXXXXXXXXXTSSYTASLTSILTVQQLSPTMKGIDSLRGSNIPIGYPAG
Q9SDQ4________________TLFKRNQEDTISNLARLVMIVWLFLLMVLTASYTANLTSILTVQQLPSAITGIDSLRASEVPIGYQAG
| SNPs (tot: 3) |
|---|
| Position | A % | C % | G % | T % | Probability |
|---|---|---|---|---|---|
| 28 | 66 | 33 | 0.997452 | ||
| 29 | 66 | 33 | 0.997452 | ||
| 31 | 33 | 66 | 0.997452 |
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
