UniGene Name: sp_v3.0_unigene106564
Length: 235 nt
UniGene Fasta |
---|
>sp_v3.0_unigene106564
T |
Ace file of the UniGene sp_v3.0_unigene106564 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | O-fucosyltransferase-like protein [Arabidopsis thaliana] gb|AAK25969.1|AF360259_1 putative axi 1 protein from Nicotiana tabacum [Arabidopsis thaliana] gb|AAN71964.1| putative axi 1 protein from Nicotiana tabacum [Arabidopsis thaliana] gb|AEC09474.1| O-fuc | - | - | 3.0e-28 | 77% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 79% |
Sma3 | Growth regulator like protein | - | - | 1.245e-22 | - |
Source | Gene names |
---|---|
Sma3 | AT4g16650; AT4g24530; At1g04910; At1g14020; At1g29200; At2g03280; At2g37980; At3g02250; At3g26370; At3g54100; At4g16650; At4g24530; At5g01100; At5g15740; At5g35570; At5g65470; B1121A12.18; F12K8.19; F13M7.10; F14F8_120; F14P3.10; F22K18.270; F24B22.60; F7 |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Golgi membrane | GO:0000139 | Cellular Component | 0.0 | - |
Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
Sma3 | cytoplasm | GO:0005737 | Cellular Component | 0.0 | - |
Sma3 | Golgi apparatus | GO:0005794 | Cellular Component | 0.0 | - |
Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
Sma3 | nucleic acid binding | GO:0003676 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | zinc ion binding | GO:0008270 | Molecular Function | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Heat shock protein Hsp70 | IPR001023 | - | 0.0 | - |
Sma3 | SKP1 component | IPR001232 | - | 0.0 | - |
Sma3 | WD40 repeat | IPR001680 | - | 0.0 | - |
Sma3 | Zinc finger, CCHC-type | IPR001878 | - | 0.0 | - |
Sma3 | Transposase, MuDR, plant | IPR004332 | - | 0.0 | - |
Sma3 | IPR004348 | - | 0.0 | - | |
Sma3 | Zinc finger, PMZ-type | IPR006564 | - | 0.0 | - |
Sma3 | Zinc finger, SWIM-type | IPR007527 | - | 0.0 | - |
Sma3 | BTB/POZ fold | IPR011333 | - | 0.0 | - |
Sma3 | Heat shock protein 70 | IPR013126 | - | 0.0 | - |
Sma3 | IPR015706 | - | 0.0 | - | |
Sma3 | WD40/YVTN repeat-like-containing domain | IPR015943 | - | 0.0 | - |
Sma3 | SKP1 component, dimerisation | IPR016072 | - | 0.0 | - |
Sma3 | Heat shock protein 70, conserved site | IPR018181 | - | 0.0 | - |
Sma3 | MULE transposase domain | IPR018289 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT2G37980.1 | O-fucosyltransferase family protein chr2:15894162-15897452 REVERSE LENGTH=638 | 2.0e-35 | 77% |
RefSeq | Arabidopsis thaliana | NP_181334.1 | O-fucosyltransferase-like protein [Arabidopsis thaliana] | 3.0e-35 | 77% |
RefSeq | Populus trichocarpa | XP_002326282.1 | predicted protein [Populus trichocarpa] | 6.0e-37 | 76% |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: B8LQ81
Fln msg: Distance to subject end: 323 aas, your sequence is shorter than subject: 77 - 634
Fln protein:
L
Protein Length:
78
Fln nts:
T
Fln Alignment:
AllPine_a_c38442___LVNANGGLNQMRTGICDMVAVARIVNATLVLPSLDHSSFWSDPSGFKDLFDWHHFIDTLKDDINIVESLPPLYAKVE
B8LQ81________________LVHANGGLNQMRTGICDMVAVARIMNATLVLPSLDHSSFWTDPSDFEDIFDWHHFTKTLREDVRIVKSLPASYAKIE
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain