UniGene Name: sp_v3.0_unigene106134
Length: 186 nt
UniGene Fasta
|
|---|
| >sp_v3.0_unigene106134
T |
Ace file of the UniGene sp_v3.0_unigene106134
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Cinnamoyl-CoA reductase, putative n=1 Tax=Ricinus communis RepID=B9RVL9_RICCO | - | - | 3.0e-08 | 73% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 86% |
| Sma3 | Dihydroflavonol 4-reductase | - | - | 0.0 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Dihydrokaempferol 4-reductase. | EC:1.1.1.219 | - | 1.275e-32 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Flavonoid biosynthesis | 00941 | 1.275e-32 | % | |
| Sma3 | Biosynthesis of phenylpropanoids | 01061 | 1.275e-32 | % | |
| Sma3 | Metabolic pathways | 01100 | 1.275e-32 | % | |
| Sma3 | Biosynthesis of secondary metabolites | 01110 | 1.275e-32 | % | |
| Sma3 | Cinnamoyl-CoA reductase. | EC:1.2.1.44 | - | 1.654e-12 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Phenylpropanoid biosynthesis | 00940 | 1.654e-12 | % | |
| Sma3 | Biosynthesis of phenylpropanoids | 01061 | 1.654e-12 | % | |
| Sma3 | Metabolic pathways | 01100 | 1.654e-12 | % | |
| Sma3 | Biosynthesis of secondary metabolites | 01110 | 1.654e-12 | % |
| Source | Gene names |
|---|---|
| Sma3 | A; ADH; AN6; AT1G15950; AT4g27250; ApDFR; At1g09490; At1g09500; At1g15950; At1g76470; At1g80820; At4g27250; CAD; CAD1; CAD1-1; CAD1-7; CCR; CCR1; CCRL3; CCRL4; CCRL5; CtDFR; DFR; DFR-A; DFR-B; DFR-BN-1; DFR-BO-1; DFR-C; DFR-FL2; DFR1; DFR2; DFR5; DFRA; Df |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
| Sma3 | catalytic activity | GO:0003824 | Molecular Function | 0.0 | - |
| Sma3 | 3-beta-hydroxy-delta5-steroid dehydrogenase activity | GO:0003854 | Molecular Function | 0.0 | - |
| Sma3 | binding | GO:0005488 | Molecular Function | 0.0 | - |
| Sma3 | transcription repressor activity | GO:0016564 | Molecular Function | 0.0 | - |
| Sma3 | cinnamoyl-CoA reductase activity | GO:0016621 | Molecular Function | 0.0 | - |
| Sma3 | dihydrokaempferol 4-reductase activity | GO:0045552 | Molecular Function | 0.0 | - |
| Sma3 | coenzyme binding | GO:0050662 | Molecular Function | 0.0 | - |
| Sma3 | steroid biosynthetic process | GO:0006694 | Biological Process | 0.0 | - |
| Sma3 | regulation of nitrogen utilization | GO:0006808 | Biological Process | 0.0 | - |
| Sma3 | flavonoid biosynthetic process | GO:0009813 | Biological Process | 0.0 | - |
| Sma3 | cellular metabolic process | GO:0044237 | Biological Process | 0.0 | - |
| Sma3 | oxidation-reduction process | GO:0055114 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Bacterial transferase hexapeptide repeat | IPR001451 | - | 0.0 | - |
| Sma3 | NAD-dependent epimerase/dehydratase | IPR001509 | - | 0.0 | - |
| Sma3 | 3-beta hydroxysteroid dehydrogenase/isomerase | IPR002225 | - | 0.0 | - |
| Sma3 | eIF4-gamma/eIF5/eIF2-epsilon | IPR003307 | - | 0.0 | - |
| Sma3 | NmrA-like | IPR008030 | - | 0.0 | - |
| Sma3 | NAD(P)-binding domain | IPR016040 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT1G09490.1 | NAD(P)-binding Rossmann-fold superfamily protein chr1:3064172-3065815 FORWARD LENGTH=322 | 6.0e-13 | 75% |
| RefSeq | Arabidopsis thaliana | NP_172420.1 | Rossmann-fold NAD(P)-binding domain-containing protein [Arabidopsis thaliana] | 7.0e-13 | 75% |
| RefSeq | Populus trichocarpa | XP_002319268.1 | predicted protein [Populus trichocarpa] | 1.0e-11 | 90% |
Full-Lengther Next Prediction |
|---|
Fln status: Putative N-terminus
Fln database: coniferopsida.fasta
Fln subject: A9P186
Fln msg: Unexpected STOP codon at 3' end. Distance to subject end: 165 aas, atg_distance in limit (1-15): atg_distance = 2, W2: There is no M at the beginning, your sequence is shorter than subject: 61 - 227
Fln protein:
E
Protein Length:
62
Fln nts:
T
Fln Alignment:
AllPine_a_c37860___EIQEGKGGVKVCVTGAGGYIGSWLVKNLLQRGYTVNATLRDPR
A9P186________________QIQEAKAGVKMCVTGAGGYIGSWLVKNLLQRGYAVNATLRDPQ

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
UniGene Fasta