|
||||||
|
UniGene Name: sp_v3.0_unigene105506
Length: 208 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene105506
A |
|
Ace file of the UniGene sp_v3.0_unigene105506
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Putative lipoxygenase [Oryza sativa Japonica Group] | - | - | 1.0e-22 | 71% |
| FL-Next | sp=Lipoxygenase; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 73% |
| Sma3 | Lipoxygenase | - | - | 0.0 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Lipoxygenase. | EC:1.13.11.12 | - | 0.0 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Linoleic acid metabolism | 00591 | 0.0 | % | |
| Sma3 | alpha-Linolenic acid metabolism | 00592 | 0.0 | % | |
| Sma3 | Biosynthesis of plant hormones | 01070 | 0.0 | % | |
| Sma3 | Metabolic pathways | 01100 | 0.0 | % |
| Source | Gene names |
|---|---|
| Sma3 | ACRE44; At1g17420; At1g55020; At1g67560; At1g72520; At3g45140; AtLOX6; B1168A08.24; B1168A08.28-1; B1168A08.28-2; CM-LOX1; CM-LOX2; F12B7.11; F14C21.3; F14C21.54; F28G4.10; F28P22.29; GSVIVT00004618001; GSVIVT00008869001; GSVIVT00024672001; GSVIVT00024676 |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | cytoplasm | GO:0005737 | Cellular Component | 0.0 | - |
| Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
| Sma3 | chloroplast thylakoid membrane | GO:0009535 | Cellular Component | 0.0 | - |
| Sma3 | chloroplast stroma | GO:0009570 | Cellular Component | 0.0 | - |
| Sma3 | chloroplast envelope | GO:0009941 | Cellular Component | 0.0 | - |
| Sma3 | iron ion binding | GO:0005506 | Molecular Function | 0.0 | - |
| Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
| Sma3 | electron carrier activity | GO:0009055 | Molecular Function | 0.0 | - |
| Sma3 | lipoxygenase activity | GO:0016165 | Molecular Function | 0.0 | - |
| Sma3 | phytoene dehydrogenase activity | GO:0016166 | Molecular Function | 0.0 | - |
| Sma3 | response to wounding | GO:0009611 | Biological Process | 0.0 | - |
| Sma3 | response to fungus | GO:0009620 | Biological Process | 0.0 | - |
| Sma3 | jasmonic acid biosynthetic process | GO:0009695 | Biological Process | 0.0 | - |
| Sma3 | response to jasmonic acid stimulus | GO:0009753 | Biological Process | 0.0 | - |
| Sma3 | oxylipin biosynthetic process | GO:0031408 | Biological Process | 0.0 | - |
| Sma3 | root development | GO:0048364 | Biological Process | 0.0 | - |
| Sma3 | response to other organism | GO:0051707 | Biological Process | 0.0 | - |
| Sma3 | oxidation-reduction process | GO:0055114 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Ketose-bisphosphate aldolase, class-II | IPR000771 | - | 0.0 | - |
| Sma3 | Peptidase M14, carboxypeptidase A | IPR000834 | - | 0.0 | - |
| Sma3 | Lipoxygenase | IPR000907 | - | 0.0 | - |
| Sma3 | Lipoxygenase, LH2 | IPR001024 | - | 0.0 | - |
| Sma3 | WW/Rsp5/WWP | IPR001202 | - | 0.0 | - |
| Sma3 | Lipoxygenase, plant | IPR001246 | - | 0.0 | - |
| Sma3 | Lipoxygenase, C-terminal | IPR013819 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT1G72520.1 | LOX4 PLAT/LH2 domain-containing lipoxygenase family protein chr1:27308611-27312589 FORWARD LENGTH=926 | 4.0e-24 | 66% |
| RefSeq | Arabidopsis thaliana | NP_177396.1 | lipoxygenase 4 [Arabidopsis thaliana] | 5.0e-24 | 66% |
| RefSeq | Populus trichocarpa | XP_002331196.1 | predicted protein [Populus trichocarpa] | 1.0e-27 | 73% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: C0PT31
Fln msg: Distance to subject end: 457 aas, your sequence is shorter than subject: 68 - 924
Fln protein:
S
Protein Length:
69
Fln nts:
A
Fln Alignment:
AllPine_a_c36992___ESVQRIGQGLLRYDTPSIISKDRFAWLRDDEFARQTLAGVNPVSIELLKVFPPKSKLDPEIYGSPES
C0PT31________________KNMLKTGEELLRYEIPSIISRDRFAWLRDNEFGRQTLAGVNPVSIERLKEFPIFSKLDPAIYGSPES
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
