UniGene Name: sp_v3.0_unigene105368
Length: 217 nt
UniGene Fasta |
---|
>sp_v3.0_unigene105368
A |
Ace file of the UniGene sp_v3.0_unigene105368 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Snf2 histone linker phd ring helicase, putative n=1 Tax=Ricinus communis RepID=B9S4G9_RICCO | - | - | 2.0e-17 | 59% |
FL-Next | tr=Snf2 histone linker phd ring helicase, putative; Ricinus communis (Castor bean). | - | - | 0.0 | 59% |
Source | Gene names |
---|---|
Sma3 | GSVIVT00029471001; RCOM_0690170; VITISV_013126; |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | DNA binding | GO:0003677 | Molecular Function | 0.0 | - |
Sma3 | RNA binding | GO:0003723 | Molecular Function | 0.0 | - |
Sma3 | RNA-directed DNA polymerase activity | GO:0003964 | Molecular Function | 0.0 | - |
Sma3 | helicase activity | GO:0004386 | Molecular Function | 0.0 | - |
Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | zinc ion binding | GO:0008270 | Molecular Function | 0.0 | - |
Sma3 | RNA-dependent DNA replication | GO:0006278 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | SNF2-related | IPR000330 | - | 0.0 | - |
Sma3 | Reverse transcriptase | IPR000477 | - | 0.0 | - |
Sma3 | Helicase, C-terminal | IPR001650 | - | 0.0 | - |
Sma3 | Zinc finger, RING-type | IPR001841 | - | 0.0 | - |
Sma3 | Zinc finger, PHD-type | IPR001965 | - | 0.0 | - |
Sma3 | Endonuclease/exonuclease/phosphatase | IPR005135 | - | 0.0 | - |
Sma3 | Helicase, superfamily 1/2, ATP-binding domain | IPR014001 | - | 0.0 | - |
Sma3 | IPR014021 | - | 0.0 | - | |
Sma3 | IPR015706 | - | 0.0 | - | |
Sma3 | Zinc finger, RING-type, conserved site | IPR017907 | - | 0.0 | - |
Sma3 | Claudin, conserved site | IPR017974 | - | 0.0 | - |
Sma3 | Zinc finger, C3HC4 RING-type | IPR018957 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT2G40770.1 | " zinc ion binding;DNA binding;helicases;ATP binding;nucleic acid binding chr2:17013535-17021315 REVERSE LENGTH=1664" | 3.0e-17 | 45% |
RefSeq | Arabidopsis thaliana | NP_181609.4 | RING-finger, DEAD-like helicase, PHD and SNF2 domain-containing protein [Arabidopsis thaliana] | 3.0e-17 | 45% |
RefSeq | Populus trichocarpa | XP_002329202.1 | chromatin remodeling complex subunit [Populus trichocarpa] | 2.0e-19 | 51% |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: tr_plants
Fln subject: B9S4G9
Fln msg: Distance to subject end: 523 aas, your sequence is shorter than subject: 72 - 1588
Fln protein:
K
Protein Length:
73
Fln nts:
A
Fln Alignment:
AllPine_a_c36813___KYIVQSGLDALENLRKALVDRLLDVDKMMDNPSDADIERVRSCSNCQTTDGGLLCLHCEMDELFQVYENKLF
B9S4G9________________KYHIQTRLDQLEASRKTLLDRLLEIDLTMGQPKEADIERVRFCRICQAVDDGPICLHCELDELFQDYEARLF
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain