UniGene Name: sp_v3.0_unigene105177
Length: 223 nt
![]() |
---|
>sp_v3.0_unigene105177
A |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Cytokinin receptor AtAHK4-like protein n=1 Tax=Physcomitrella patens subsp. patens RepID=A9TKN3_PHYPA | - | - | 2.0e-19 | 73% |
FL-Next | Isoform 2 of Histidine kinase 4 OS=Arabidopsis thaliana GN=AHK4 | - | - | 0.0 | 78% |
Sma3 | Histidine kinase | - | - | 1.829e-31 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Histidine kinase. | EC:2.7.13.3 | - | 1.425e-06 | - |
Source | Gene names |
---|---|
Sma3 | AHK2; AHK3; AHK4; At1g27320; At2g01830; At5g35750; B1455F06.33; CKI3a; CKI3b; CKR1; CRE1; CRE1A; CRE1B; CRE2; CRE3; GSVIVT00002792001; GSVIVT00029130001; GSVIVT00030632001; HK1; HK2; HK3; HK3A; HK3B; LOC_Os03g50860; LOC_Os10g21810; OHK2; OHK3; OHK3b; OHK4 |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
Sma3 | two-component sensor activity | GO:0000155 | Molecular Function | 0.0 | - |
Sma3 | two-component response regulator activity | GO:0000156 | Molecular Function | 0.0 | - |
Sma3 | receptor activity | GO:0004872 | Molecular Function | 0.0 | - |
Sma3 | osmosensor activity | GO:0005034 | Molecular Function | 0.0 | - |
Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | cytokinin receptor activity | GO:0009884 | Molecular Function | 0.0 | - |
Sma3 | identical protein binding | GO:0042802 | Molecular Function | 0.0 | - |
Sma3 | two-component signal transduction system (phosphorelay) | GO:0000160 | Biological Process | 0.0 | - |
Sma3 | regulation of transcription, DNA-dependent | GO:0006355 | Biological Process | 0.0 | - |
Sma3 | signal transduction | GO:0007165 | Biological Process | 0.0 | - |
Sma3 | response to cold | GO:0009409 | Biological Process | 0.0 | - |
Sma3 | response to water deprivation | GO:0009414 | Biological Process | 0.0 | - |
Sma3 | response to salt stress | GO:0009651 | Biological Process | 0.0 | - |
Sma3 | cytokinin mediated signaling pathway | GO:0009736 | Biological Process | 0.0 | - |
Sma3 | response to abscisic acid stimulus | GO:0009737 | Biological Process | 0.0 | - |
Sma3 | regulation of seed germination | GO:0010029 | Biological Process | 0.0 | - |
Sma3 | leaf senescence | GO:0010150 | Biological Process | 0.0 | - |
Sma3 | regulation of chlorophyll catabolic process | GO:0010271 | Biological Process | 0.0 | - |
Sma3 | peptidyl-histidine phosphorylation | GO:0018106 | Biological Process | 0.0 | - |
Sma3 | regulation of shoot development | GO:0048831 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Signal transduction response regulator, receiver domain | IPR001789 | - | 0.0 | - |
Sma3 | ATPase-like, ATP-binding domain | IPR003594 | - | 0.0 | - |
Sma3 | Signal transduction histidine kinase, subgroup 1, dimerisation/phosphoacceptor domain | IPR003661 | - | 0.0 | - |
Sma3 | Signal transduction histidine kinase-related protein, C-terminal | IPR004358 | - | 0.0 | - |
Sma3 | Signal transduction histidine kinase, core | IPR005467 | - | 0.0 | - |
Sma3 | CHASE | IPR006189 | - | 0.0 | - |
Sma3 | Glycoside hydrolase, family 5, conserved site | IPR018087 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT2G01830.2 | WOL, CRE1, WOL1, AHK4, ATCRE1 CHASE domain containing histidine kinase protein chr2:363332-368016 REVERSE LENGTH=1080 | 7.0e-22 | 78% |
RefSeq | Arabidopsis thaliana | NP_565277.1 | histidine kinase 4 [Arabidopsis thaliana] | 9.0e-22 | 78% |
RefSeq | Populus trichocarpa | XP_002312478.1 | histidine kinase cytokinin receptor [Populus trichocarpa] | 8.0e-22 | 79% |
![]() |
---|
Fln status: Internal
Fln database: sp_plants
Fln subject: Q9C5U0-2
Fln msg: Distance to subject end: 522 aas, your sequence is shorter than subject: 74 - 1057
Fln protein:
M
Protein Length:
75
Fln nts:
A
Fln Alignment:
AllPine_a_c36530___SPMNGVLGXXXXXXXXXXXXXXXXYARTAQASGKALITLINEVLDRAKIESGRLELETVPFDLRAILDDVLSL
Q9C5U0-2______________TPMNGILGMLAMLLDTELSSTQRDYAQTAQVCGKALIALINEVLDRAKIEAGKLELESVPFDIRSILDDVLSL
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain