UniGene Name: sp_v3.0_unigene105043
Length: 230 nt
UniGene Fasta
|
|---|
| >sp_v3.0_unigene105043
A |
Ace file of the UniGene sp_v3.0_unigene105043
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | cytochrome P450 86B1 [Arabidopsis thaliana] gb|AAM97029.1| cytochrome P450-like protein [Arabidopsis thaliana] gb|AAN15497.1| cytochrome P450-like protein [Arabidopsis thaliana] dbj|BAE99010.1| cytochrome P450 like protein [Arabidopsis thaliana] gb|AED912 | - | - | 3.0e-17 | 60% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 50% |
| Sma3 | Cytochrome P450, putative | - | - | 3.375e-09 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Unspecific monooxygenase. | EC:1.14.14.1 | - | 4.813e-10 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Fatty acid metabolism | 00071 | 4.813e-10 | % | |
| Sma3 | Steroid hormone biosynthesis | 00140 | 4.813e-10 | % | |
| Sma3 | Caffeine metabolism | 00232 | 4.813e-10 | % | |
| Sma3 | Tryptophan metabolism | 00380 | 4.813e-10 | % | |
| Sma3 | Arachidonic acid metabolism | 00590 | 4.813e-10 | % | |
| Sma3 | Linoleic acid metabolism | 00591 | 4.813e-10 | % | |
| Sma3 | Aminobenzoate degradation | 00627 | 4.813e-10 | % | |
| Sma3 | Retinol metabolism | 00830 | 4.813e-10 | % | |
| Sma3 | Metabolism of xenobiotics by cytochrome P450 | 00980 | 4.813e-10 | % | |
| Sma3 | Drug metabolism - cytochrome P450 | 00982 | 4.813e-10 | % | |
| Sma3 | Drug metabolism - other enzymes | 00983 | 4.813e-10 | % | |
| Sma3 | Biosynthesis of alkaloids derived from shikimate pathway | 01063 | 4.813e-10 | % | |
| Sma3 | Metabolic pathways | 01100 | 4.813e-10 | % |
| Source | Gene names |
|---|---|
| Sma3 | AT1G57750; A_IG005I10.21; At1g01600; At1g01600/F22L4_10; At1g57750; At1g63710; At1g65340; At2g45970; At4g00360; At5g08250; At5g23190; At5g52320; At5g52320/K24M7_5; B0103C08-B0602B01.11; B1096A10.16; CYP86A19; CYP86A2; CYP86A20; CYP86A24; CYP86B4; CYP96A17 |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | endoplasmic reticulum | GO:0005783 | Cellular Component | 0.0 | - |
| Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
| Sma3 | monooxygenase activity | GO:0004497 | Molecular Function | 0.0 | - |
| Sma3 | iron ion binding | GO:0005506 | Molecular Function | 0.0 | - |
| Sma3 | GO:0008393 | Molecular Function | 0.0 | - | |
| Sma3 | electron carrier activity | GO:0009055 | Molecular Function | 0.0 | - |
| Sma3 | heme binding | GO:0020037 | Molecular Function | 0.0 | - |
| Sma3 | fatty acid metabolic process | GO:0006631 | Biological Process | 0.0 | - |
| Sma3 | wax biosynthetic process | GO:0010025 | Biological Process | 0.0 | - |
| Sma3 | oxidation-reduction process | GO:0055114 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | RNA helicase, ATP-dependent, DEAD-box, conserved site | IPR000629 | - | 0.0 | - |
| Sma3 | Cytochrome P450 | IPR001128 | - | 0.0 | - |
| Sma3 | Lipocalin | IPR002345 | - | 0.0 | - |
| Sma3 | Cytochrome P450, E-class, group I | IPR002401 | - | 0.0 | - |
| Sma3 | EGF-like region, conserved site | IPR013032 | - | 0.0 | - |
| Sma3 | Cytochrome P450, conserved site | IPR017972 | - | 0.0 | - |
| Sma3 | IPR017973 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT5G08250.1 | Cytochrome P450 superfamily protein chr5:2653766-2655595 REVERSE LENGTH=488 | 1.0e-22 | 60% |
| RefSeq | Arabidopsis thaliana | NP_196442.2 | cytochrome P450 86B1 [Arabidopsis thaliana] | 2.0e-22 | 60% |
| RefSeq | Populus trichocarpa | XP_002306380.1 | cytochrome P450 [Populus trichocarpa] | 1.0e-22 | 58% |
Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: D5A7Y6
Fln msg: Distance to subject end: 76 aas, your sequence is shorter than subject: 76 - 559
Fln protein:
M
Protein Length:
77
Fln nts:
A
Fln Alignment:
AllPine_a_c36339___STLTETLRLYPSVPNDHKGVLHRDVLPNGTCIEPGMKFVYNIYALGRMQSVWGPDSLDFKPERWID
D5A7Y6________________ASICESMRLYPPVLLDSKHALHNDVLPDGTFVGKGTRVTYHPYAMGRMNAIWGADCLQFKPERWVN

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
UniGene Fasta