SustainPineDB

All assemblies
Assembly info
Unigenes
SNPs
SSRs
Descriptions
GOs
ECs
KEGGs
InterPros
miRNAs

Assembly Name: SustainPine v3.0

UniGene Name: sp_v3.0_unigene104059

Length: 331 nt

UniGene Fasta

>sp_v3.0_unigene104059
GTTCCAAGCAAATCTCAACGTAAGAGCGGTCGTGTCCCAATGCCTGATTCTCACCTGGATCAATCGGACCTGGTTCTTCCAGGAATTGGCAGGCTGGGCATTCGACTAGGTGTGAACATGCCTGCCAGGGCGAATCGTAGGCCACCAAGAAGTGAACGTGATTCTCATCCTGAGGGAGAGTTGTTTCGTGAGGATTATGACGTAGTGTTATATTTTGGAATTATTGATATTCTTCAAGACTATGATATCACTAAGAAACTTGAACATGCGTACAAGTCTTTGCAATTTGATTCTCTATCAATTTCAGCTGTAGATCCGAAACTGTACTCCA

Ace file of the UniGene sp_v3.0_unigene104059

If you push the Download ace button, you will download an ace file of this UniGene.

To watch this ACE file you will need an ACE viewer program as Tablet:

Go to the Tablet ACE viewer Web

Annotations

Source	Descriptions	Term	Type	e value	Identity
AutoFact	Phosphatidylinositol phoshate kinase n=2 Tax=Physcomitrella patens RepID=B5TVL9_9BRYO	-	-	1.0e-16	66%
FL-Next	Isoform 2 of Phosphatidylinositol 4-phosphate 5-kinase 2 OS=Arabidopsis thaliana GN=PIP5K2	-	-	0.0	85%
Sma3	Phosphatidylinositol-4-phosphate 5-kinase, putative	-	-	8.839e-20	-

Source	ECs	Term	Type	e value	Identity
Sma3	1-phosphatidylinositol-4-phosphate 5-kinase.	EC:2.7.1.68	-	0.0	-

Source	KEGGs	Term	Identity
Sma3	Inositol phosphate metabolism	00562	%
Sma3	Metabolic pathways	01100	%
Sma3	Phosphatidylinositol signaling system	04070	%

Source	Gene names
Sma3	At1g10900; At1g21980; At1g60890; At1g77740; At2g26420; At2g41210; At3g07960; At3g09920; At3g56960; F17A17.30; F24I3.40; F2E2.1; F8A24.2; GSVIVT00000598001; GSVIVT00000653001; GSVIVT00015324001; GSVIVT00026524001; GSVIVT00030918001; LOC_Os03g15550; LOC_Os0

Source	GOs	Term	Type	Identity
Sma3	nucleus	GO:0005634	Cellular Component	-
Sma3	cytoplasm	GO:0005737	Cellular Component	-
Sma3	cytosol	GO:0005829	Cellular Component	-
Sma3	plasma membrane	GO:0005886	Cellular Component	-
Sma3	membrane	GO:0016020	Cellular Component	-
Sma3	apical plasma membrane	GO:0016324	Cellular Component	-
Sma3	cytosolic part	GO:0044445	Cellular Component	-
Sma3	actin monomer binding	GO:0003785	Molecular Function	-
Sma3	protein binding	GO:0005515	Molecular Function	-
Sma3	ATP binding	GO:0005524	Molecular Function	-
Sma3	phosphatidylinositol phosphate kinase activity	GO:0016307	Molecular Function	-
Sma3	1-phosphatidylinositol-4-phosphate 5-kinase activity	GO:0016308	Molecular Function	-
Sma3	actin filament binding	GO:0051015	Molecular Function	-
Sma3	carbohydrate metabolic process	GO:0005975	Biological Process	-
Sma3	cellular amino acid metabolic process	GO:0006520	Biological Process	-
Sma3	endocytosis	GO:0006897	Biological Process	-
Sma3	response to stress	GO:0006950	Biological Process	-
Sma3	establishment of tissue polarity	GO:0007164	Biological Process	-
Sma3	plant-type cell wall modification	GO:0009827	Biological Process	-
Sma3	pollen germination	GO:0009846	Biological Process	-
Sma3	pollen tube growth	GO:0009860	Biological Process	-
Sma3	flower development	GO:0009908	Biological Process	-
Sma3	stomatal movement	GO:0010118	Biological Process	-
Sma3	cell differentiation	GO:0030154	Biological Process	-
Sma3	phosphatidylinositol metabolic process	GO:0046488	Biological Process	-
Sma3	root hair cell tip growth	GO:0048768	Biological Process	-

Source	InterPros	Term	Type	Identity
Sma3	Peptidase, cysteine peptidase active site	IPR000169	-	-
Sma3	Short-chain dehydrogenase/reductase SDR	IPR002198	-	-
Sma3	Phosphatidylinositol-4-phosphate 5-kinase, core	IPR002498	-	-
Sma3	MORN motif	IPR003409	-	-
Sma3	Phosphatidylinositol-4-phosphate 5-kinase, core, subgroup	IPR016034	-	-
Sma3	Phosphatidylinositol-4-phosphate 5-kinase, plant	IPR017163	-	-

Source	Species	ID	Description	e value	Identity
ATG	Arabidoptis thaliana	AT1G21980.1	ATPIP5K1, ATPIPK1, PIP5K1 phosphatidylinositol-4-phosphate 5-kinase 1 chr1:7735053-7738309 FORWARD LENGTH=752	3.0e-19	85%
RefSeq	Arabidopsis thaliana	NP_173617.1	phosphatidylinositol-4-phosphate 5-kinase 1 [Arabidopsis thaliana]	3.0e-19	85%
RefSeq	Populus trichocarpa	XP_002325695.1	predicted protein [Populus trichocarpa]	9.0e-20	76%

Full-Lengther Next Prediction

Fln status: Putative C-terminus

Fln database: sp_plants

Fln subject: Q8L796-2

Fln msg: STOP codon was not found. Distance to subject end: 15 aas, your sequence is shorter than subject: 110 - 318

Fln protein: VPSKSQRKSGRVPMPDSHLDQSDLVLPGIGRLGIRLGVNMPARANRRPPRSERDSHPEGELFREDYDVVLYFGIIDILQDYDITKKLEHAYKSLQFDSLSISAVDPKLYS

Protein Length: 111

Fln nts: GTTCCAAGCAAATCTCAACGTAAGAGCGGTCGTGTCCCAATGCCTGATTCTCACCTGGATCAATCGGACCTGGTTCTTCCAGGAATTGGCAGGCTGGGCATTCGACTAGGTGTGAACATGCCTGCCAGGGCGAATCGTAGGCCACCAAGAAGTGAACGTGATTCTCATCCTGAGGGAGAGTTGTTTCGTGAGGATTATGACGTAGTGTTATATTTTGGAATTATTGATATTCTTCAAGACTATGATATCACTAAGAAACTTGAACATGCGTACAAGTCTTTGCAATTTGATTCTCTATCAATTTCAGCTGTAGATCCGAAACTGTACTCCA

Fln Alignment:

AllPine_a_c34790___EDYDVVLYFGIIDILQDYDITKKLEHAYKSLQFDSLSISAVDPKLYS
Q8L796-2______________EVYEVVLYFGIIDILQDYDISKKIEHAYKSLQADPASISAVDPKLYS

SNPs (tot: 1)

Position	A %	C %	G %	T %	Probability
99		75		25	0.996474

Back

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain