UniGene Name: sp_v3.0_unigene103821
Length: 243 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
UniGene Fasta (sense)
|
|---|
| >sp_v3.0_unigene103821
G |
Ace file of the UniGene sp_v3.0_unigene103821 (antisense)
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | P-type transporting ATPase-like protein [Arabidopsis thaliana] | - | - | 2.0e-32 | 91% |
| FL-Next | sp=Putative phospholipid-transporting ATPase 7; Arabidopsis thaliana (Mouse-ear cress). | - | - | 0.0 | 91% |
| Sma3 | Aminophospholipid ATPase | - | - | 2.91498e-41 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Phospholipid-translocating ATPase. | EC:3.6.3.1 | - | 0.0 | - |
| Source | Gene names |
|---|---|
| Sma3 | ALA1; ALA10; ALA11; ALA12; ALA2; ALA3; ALA4; ALA5; ALA6; ALA7; ALA8; ALA9; ATPase-P4; At1g13210; At1g17500; At1g26130; At1g54280; At1g59820; At1g68710; At1g72700; At3g13900; At3g25610; At3g27870; At5g04930; At5g44240; CHLREDRAFT_172401; CHLREDRAFT_190292; |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Golgi apparatus | GO:0005794 | Cellular Component | 0.0 | - |
| Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
| Sma3 | chloroplast envelope | GO:0009941 | Cellular Component | 0.0 | - |
| Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
| Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
| Sma3 | magnesium ion binding | GO:0000287 | Molecular Function | 0.0 | - |
| Sma3 | phospholipid-translocating ATPase activity | GO:0004012 | Molecular Function | 0.0 | - |
| Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
| Sma3 | ATPase activity, coupled to transmembrane movement of ions, phosphorylative mechanism | GO:0015662 | Molecular Function | 0.0 | - |
| Sma3 | ATP biosynthetic process | GO:0006754 | Biological Process | 0.0 | - |
| Sma3 | phospholipid transport | GO:0015914 | Biological Process | 0.0 | - |
| Sma3 | Golgi vesicle budding | GO:0048194 | Biological Process | 0.0 | - |
| Sma3 | root development | GO:0048364 | Biological Process | 0.0 | - |
| Sma3 | shoot development | GO:0048367 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | ATPase, P-type, K/Mg/Cd/Cu/Zn/Na/Ca/Na/H-transporter | IPR001757 | - | 0.0 | - |
| Sma3 | Haloacid dehalogenase-like hydrolase | IPR005834 | - | 0.0 | - |
| Sma3 | ATPase, P-type cation exchange, alpha subunit | IPR006069 | - | 0.0 | - |
| Sma3 | ATPase, P-type, phospholipid-translocating, flippase | IPR006539 | - | 0.0 | - |
| Sma3 | ATPase, P-type, ATPase-associated domain | IPR008250 | - | 0.0 | - |
| Sma3 | HAD superfamily hydrolase-like, type 3 | IPR013200 | - | 0.0 | - |
| Sma3 | Aldehyde dehydrogenase, conserved site | IPR016160 | - | 0.0 | - |
| Sma3 | Somatotropin hormone, conserved site | IPR018116 | - | 0.0 | - |
| Sma3 | ATPase, P-type phosphorylation site | IPR018303 | - | 0.0 | - |
| Sma3 | Formate C-acetyltransferase glycine radical, conserved site | IPR019777 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT3G13900.1 | ATPase E1-E2 type family protein / haloacid dehalogenase-like hydrolase family protein chr3:4586151-4590681 FORWARD LENGTH=1243 | 1.0e-39 | 91% |
| RefSeq | Arabidopsis thaliana | NP_188006.4 | phospholipid-translocating ATPase [Arabidopsis thaliana] | 2.0e-39 | 91% |
| RefSeq | Populus trichocarpa | XP_002303211.1 | predicted protein [Populus trichocarpa] | 1.99993e-41 | 91% |
Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: sp_plants
Fln subject: Q9LVK9
Fln msg: Distance to subject end: 323 aas, your sequence is shorter than subject: 80 - 1243
Fln protein:
A
Protein Length:
81
Fln nts:
G
Fln Alignment:
AllPine_a_c34392___DLKDQFLQLAILCASVICCRVSPKQKALVTRLVKEGTHKTTLAIGDGANDVGMIQEADIGVGISGVEGMQAVMASDFSI
Q9LVK9________________DIKYQFLALAVDCASVICCRVSPKQKALVTRLAKEGTGKTTLAIGDGANDVGMIQEADIGVGISGVEGMQAVMASDFSI

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
UniGene Fasta (sense)