|
||||||
|
UniGene Name: sp_v3.0_unigene103188
Length: 226 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
 UniGene Fasta (sense)
|
|---|
| >sp_v3.0_unigene103188
C |
|
Ace file of the UniGene sp_v3.0_unigene103188 (antisense)
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Iron(III)-zinc(II) purple acid phosphatase, putative n=1 Tax=Ricinus communis RepID=B9RP16_RICCO | - | - | 9.0e-26 | 71% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 93% |
| Sma3 | Purple acid phosphatase | - | - | 1.4013e-45 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Acid phosphatase. | EC:3.1.3.2 | - | 0.0 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Aminobenzoate degradation | 00627 | 0.0 | % | |
| Sma3 | Riboflavin metabolism | 00740 | 0.0 | % |
| Source | Gene names |
|---|---|
| Sma3 | ACPEPP; AP1; AT11; AT2G16430; AT7; AT9; ATH2; At10; At1g52940; At1g56360; At2g16430; At2g27190; At4g36350; At5g34850; Ath1; C7A10.1010; F13N6.16; F14G24.21; F14G9.2; F16F14.7; F23E13.190; GSVIVT00014522001; GSVIVT00014523001; GSVIVT00032768001; GSVIVT0003 |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | extracellular region | GO:0005576 | Cellular Component | 0.0 | - |
| Sma3 | extracellular space | GO:0005615 | Cellular Component | 0.0 | - |
| Sma3 | cell wall | GO:0005618 | Cellular Component | 0.0 | - |
| Sma3 | vacuole | GO:0005773 | Cellular Component | 0.0 | - |
| Sma3 | endoplasmic reticulum | GO:0005783 | Cellular Component | 0.0 | - |
| Sma3 | plant-type cell wall | GO:0009505 | Cellular Component | 0.0 | - |
| Sma3 | acid phosphatase activity | GO:0003993 | Molecular Function | 0.0 | - |
| Sma3 | peroxidase activity | GO:0004601 | Molecular Function | 0.0 | - |
| Sma3 | iron ion binding | GO:0005506 | Molecular Function | 0.0 | - |
| Sma3 | zinc ion binding | GO:0008270 | Molecular Function | 0.0 | - |
| Sma3 | oxidoreductase activity | GO:0016491 | Molecular Function | 0.0 | - |
| Sma3 | hydrolase activity | GO:0016787 | Molecular Function | 0.0 | - |
| Sma3 | manganese ion binding | GO:0030145 | Molecular Function | 0.0 | - |
| Sma3 | metal ion binding | GO:0046872 | Molecular Function | 0.0 | - |
| Sma3 | fatty acid biosynthetic process | GO:0006633 | Biological Process | 0.0 | - |
| Sma3 | hydrogen peroxide catabolic process | GO:0042744 | Biological Process | 0.0 | - |
| Sma3 | oxidation-reduction process | GO:0055114 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Fibronectin, type III | IPR003961 | - | 0.0 | - |
| Sma3 | Metallophosphoesterase domain | IPR004843 | - | 0.0 | - |
| Sma3 | Fatty acid hydroxylase | IPR006694 | - | 0.0 | - |
| Sma3 | Purple acid phosphatase, N-terminal | IPR015914 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT5G34850.1 | ATPAP26, PAP26 purple acid phosphatase 26 chr5:13108475-13111217 REVERSE LENGTH=475 | 5.0e-31 | 67% |
| RefSeq | Arabidopsis thaliana | NP_198334.1 | purple acid phosphatase 26 [Arabidopsis thaliana] | 7.0e-31 | 67% |
| RefSeq | Populus trichocarpa | XP_002324876.1 | predicted protein [Populus trichocarpa] | 7.0e-33 | 70% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: A9NVR5
Fln msg: Distance to subject end: 260 aas, your sequence is shorter than subject: 74 - 517
Fln protein:
T
Protein Length:
75
Fln nts:
C
Fln Alignment:
AllPine_a_c33292___TPPKIAPDAPYTFGIIGDMGQTFHSLSTFKHYLQSNGQAVLYVGDLSYADNYEYDNGIRWDTWGRFIEPSAHY
A9NVR5________________TPPKIAPDAAYTFGIIGDMGQTFNSLSTFNHYLQSNGEAVLYVGDLSYADNYEYDNGIRWDTWGRFIEPSAAY
| SNPs (tot: 3) |
|---|
| Position | A % | C % | G % | T % | Probability |
|---|---|---|---|---|---|
| 191 | 75 | 25 | 0.996474 | ||
| 211 | 25 | 75 | 0.996474 | ||
| 212 | 75 | 25 | 0.996474 |
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
