SustainPineDB

All assemblies
Assembly info
Unigenes
SNPs
SSRs
Descriptions
GOs
ECs
KEGGs
InterPros
miRNAs

Assembly Name: SustainPine v3.0

UniGene Name: sp_v3.0_unigene102446

Length: 315 nt

UniGene Fasta

>sp_v3.0_unigene102446
AATGTCAGTGTCACCCAAAGACTACATCCATGTGAGAGCAAGGAGAGGCCAAGCTACTGATAGCCATAGTCTTGCTGAGAGGGTGCGAAGAGAAAAGATCAGCGAACGTATGAAGCTTTTGCAAGATCTTGTTCCTGGATGTAATAAGATAACTGGTAAAGCAGTGATGGTTGATGAGATAATTAACTATGTACAATCACTTCAGTGCCAAGTTGAGTTTCTATCTATGAAGCTTGAAGCTGTTAATCCCAGATTGGACTTTAACCTGGAAGACTTTCTTGCCAAAGATATGCTTGAACCATCAGGTATGTCAAT

Ace file of the UniGene sp_v3.0_unigene102446

If you push the Download ace button, you will download an ace file of this UniGene.

To watch this ACE file you will need an ACE viewer program as Tablet:

Go to the Tablet ACE viewer Web

Annotations

Source	Descriptions	Term	Type	e value	Identity
AutoFact	transcription factor bHLH76 [Arabidopsis thaliana] gb\|AAS79545.1\| putative transcription factor [Arabidopsis thaliana] emb\|CAG25856.1\| hypothetical protein [Arabidopsis thaliana] gb\|AEE30669.1\| transcription factor bHLH76 [Arabidopsis thaliana]	-	-	4.0e-39	83%
FL-Next	tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis).	-	-	0.0	91%
Sma3	BHLH transcription factor	-	-	1.574e-19	-

Source	Gene names
Sma3	24.t00060; AP22.3; AT1G68920; AT4G02590; At1g03040; At1g10120; At1g18400; At1g25330; At1g26260; At1g59640; At1g68920; At1g73830; At2g18300; At2g24260; At2g42300; At3g07340; At3g23690; At3g57800; At4g02590; At4g30980; At4g34530; At4g36540; At5g48560; At5g5

Source	GOs	Term	Type	Identity
Sma3	nucleus	GO:0005634	Cellular Component	-
Sma3	plastid	GO:0009536	Cellular Component	-
Sma3	DNA binding	GO:0003677	Molecular Function	-
Sma3	sequence-specific DNA binding transcription factor activity	GO:0003700	Molecular Function	-
Sma3	transcription regulator activity	GO:0030528	Molecular Function	-
Sma3	regulation of transcription, DNA-dependent	GO:0006355	Biological Process	-
Sma3	protein modification process	GO:0006464	Biological Process	-
Sma3	multicellular organismal development	GO:0007275	Biological Process	-
Sma3	double fertilization forming a zygote and endosperm	GO:0009567	Biological Process	-
Sma3	response to cytokinin stimulus	GO:0009735	Biological Process	-
Sma3	response to gibberellin stimulus	GO:0009739	Biological Process	-
Sma3	positive regulation of flower development	GO:0009911	Biological Process	-
Sma3		GO:0045449	Biological Process	-
Sma3	petal morphogenesis	GO:0048446	Biological Process	-

Source	InterPros	Term	Type	Identity
Sma3	Histone H3	IPR000164	-	-
Sma3	Peptidase S8/S53, subtilisin/kexin/sedolisin	IPR000209	-	-
Sma3	Ubiquitin	IPR000626	-	-
Sma3		IPR001092	-	-
Sma3	F-box domain, cyclin-like	IPR001810	-	-
Sma3	Pentatricopeptide repeat	IPR002885	-	-
Sma3	Phosphopantetheine attachment site	IPR006162	-	-
Sma3	DNA-directed RNA polymerase, subunit 2, domain 6	IPR007120	-	-
Sma3	Histone core	IPR007125	-	-
Sma3	Histone-fold	IPR009072	-	-
Sma3	Helix-loop-helix DNA-binding	IPR011598	-	-
Sma3	RNA polymerase Rpb2, OB-fold	IPR014724	-	-
Sma3	DNA-directed RNA polymerase, subunit 2	IPR015712	-	-
Sma3	Peptidase S26A, signal peptidase I, serine active site	IPR019756	-	-
Sma3	WD40 repeat, conserved site	IPR019775	-	-

Source	Species	ID	Description	Identity
ATG	Arabidoptis thaliana	AT1G26260.1	CIB5 cryptochrome-interacting basic-helix-loop-helix 5 chr1:9087214-9089035 FORWARD LENGTH=390	83%
RefSeq	Arabidopsis thaliana	NP_001031093.1	transcription factor bHLH76 [Arabidopsis thaliana]	83%
RefSeq	Populus trichocarpa	XP_002301743.1	predicted protein [Populus trichocarpa]	80%

Full-Lengther Next Prediction

Fln status: Internal

Fln database: coniferopsida.fasta

Fln subject: D5AB87

Fln msg: Distance to subject end: 80 aas, your sequence is shorter than subject: 104 - 392

Fln protein: MSVSPKDYIHVRARRGQATDSHSLAERVRREKISERMKLLQDLVPGCNKITGKAVMVDEIINYVQSLQCQVEFLSMKLEAVNPRLDFNLEDFLAKDMLEPSGMS

Protein Length: 105

Fln nts: AATGTCAGTGTCACCCAAAGACTACATCCATGTGAGAGCAAGGAGAGGCCAAGCTACTGATAGCCATAGTCTTGCTGAGAGGGTGCGAAGAGAAAAGATCAGCGAACGTATGAAGCTTTTGCAAGATCTTGTTCCTGGATGTAATAAGATAACTGGTAAAGCAGTGATGGTTGATGAGATAATTAACTATGTACAATCACTTCAGTGCCAAGTTGAGTTTCTATCTATGAAGCTTGAAGCTGTTAATCCCAGATTGGACTTTAACCTGGAAGACTTTCTTGCCAAAGATATGCTTGAACCATCAGGTATGTCAAT

Fln Alignment:

AllPine_a_c31648___PKDYIHVRARRGQATDSHSLAERVRREKISERMKLLQDLVPGCNKITGKAVMVDEIINYVQSLQCQVEFLSMKLEAVNPRLDFNLEDFLAKDMLEPS
D5AB87________________PKDYIHVRARRGQATDRHSLAERVRREKIGERMKLLQDLVPGCNKITGKAVMVDEIINYVQSLQCQVEFLSMKLEAVNPKLACNMEGFLARDMLEPS

Back

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain