SustainPineDB

All assemblies
Assembly info
Unigenes
SNPs
SSRs
Descriptions
GOs
ECs
KEGGs
InterPros
miRNAs

Assembly Name: SustainPine v3.0

UniGene Name: sp_v3.0_unigene101948

Length: 294 nt

This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense

UniGene Fasta (sense)

>sp_v3.0_unigene101948
TGTACGTTTGGGTTGTACTTGGACACGAGAACTCAAAAATTCATTTGCAGAGGTATGTAAGCCTCCAATGGGTGGGAAAAGTGGCCTGTTGAGAGCAGATTATATGCAAGGAAAAACCAACCCAAGATTTCCGAGGTTGCTAATCGATGGGCCTTATGGAGCACCAGCACAAGACTATAAAAAGTATGATGTCTTGCTTCTTGTTGGTCTAGGAATCGGAGCCACTCCAACAATCAGCATTCTCAAAGACATTGTCAACCATATGAAAGTATCTGAGGAAGAAGGCAGCATTGC

Ace file of the UniGene sp_v3.0_unigene101948 (antisense)

If you push the Download ace button, you will download an ace file of this UniGene.

To watch this ACE file you will need an ACE viewer program as Tablet:

Go to the Tablet ACE viewer Web

Annotations

Source	Descriptions	Term	Type	e value	Identity
AutoFact	Respiratory burst oxidase protein 1 (Fragment) n=1 Tax=Picea abies RepID=E9N9T3_PICAB	-	-	4.0e-37	82%
FL-Next	tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis).	-	-	0.0	94%
Sma3	Respiratory burst oxidase, putative	-	-	1.313e-11	-

Source	ECs	Term	Type	e value	Identity
Sma3	Oxidoreductases, Acting on a peroxide as acceptor, Peroxidases.	EC:1.11.1.-	-	1.082e-36	-

Source	KEGGs	Term	Type	e value	Identity
Sma3	Glutathione metabolism	00480		1.082e-36	%
Sma3	Oxidoreductases, Acting on NADH or NADPH, With a oxygen as acceptor.	EC:1.6.3.-	-	5.601e-40	-
Sma3	NAD(P)H oxidase.	EC:1.6.3.1	-	5.093e-10	-

Source	Gene names
Sma3	At1g09090; At1g19230; At1g64060; At3g45810; At4g11230; At5g07390; At5g47910; At5g51060; At5g60010; B1060H01.16; B1164G11.26; F16L2.20; F22C12.18; F7G19.3; F7G19.4; F8L21.20; GSVIVT00002525001; GSVIVT00006233001; GSVIVT00006235001; GSVIVT00016386001; GSVIV

Source	GOs	Term	Type	Identity
Sma3	plasma membrane	GO:0005886	Cellular Component	-
Sma3	membrane	GO:0016020	Cellular Component	-
Sma3	integral to membrane	GO:0016021	Cellular Component	-
Sma3	peroxidase activity	GO:0004601	Molecular Function	-
Sma3	iron ion binding	GO:0005506	Molecular Function	-
Sma3	calcium ion binding	GO:0005509	Molecular Function	-
Sma3	electron carrier activity	GO:0009055	Molecular Function	-
Sma3	NAD(P)H oxidase activity	GO:0016174	Molecular Function	-
Sma3	oxidoreductase activity	GO:0016491	Molecular Function	-
Sma3	flavin adenine dinucleotide binding	GO:0050660	Molecular Function	-
Sma3	oxidoreductase activity, acting on NADH or NADPH, oxygen as acceptor	GO:0050664	Molecular Function	-
Sma3	respiratory burst involved in defense response	GO:0002679	Biological Process	-
Sma3	oxygen and reactive oxygen species metabolic process	GO:0006800	Biological Process	-
Sma3	response to heat	GO:0009408	Biological Process	-
Sma3	abscisic acid mediated signaling pathway	GO:0009738	Biological Process	-
Sma3	ethylene mediated signaling pathway	GO:0009873	Biological Process	-
Sma3	regulation of stomatal movement	GO:0010119	Biological Process	-
Sma3	negative regulation of programmed cell death	GO:0043069	Biological Process	-
Sma3	hydrogen peroxide biosynthetic process	GO:0050665	Biological Process	-
Sma3	defense response by callose deposition	GO:0052542	Biological Process	-
Sma3	oxidation-reduction process	GO:0055114	Biological Process	-

Source	InterPros	Term	Type	Identity
Sma3	Cytochrome b245, heavy chain	IPR000778	-	-
Sma3	Calcium-binding EF-hand	IPR002048	-	-
Sma3	EF-hand-like domain	IPR011992	-	-
Sma3	FAD-binding 8	IPR013112	-	-
Sma3	Ferric reductase, NAD binding	IPR013121	-	-
Sma3	Flavoprotein transmembrane component	IPR013130	-	-
Sma3	NADPH oxidase Respiratory burst	IPR013623	-	-
Sma3	Ferredoxin reductase-type FAD-binding domain	IPR017927	-	-
Sma3	EF-Hand 1, calcium-binding site	IPR018247	-	-
Sma3	EF-hand	IPR018248	-	-
Sma3	EF-HAND 2	IPR018249	-	-
Sma3	Chaperonin Cpn60, conserved site	IPR018370	-	-

Source	Species	ID	Description	e value	Identity
ATG	Arabidoptis thaliana	AT5G51060.1	RHD2, ATRBOHC, RBOHC NADPH/respiratory burst oxidase protein D chr5:20757484-20762175 REVERSE LENGTH=905	7.0e-38	68%
RefSeq	Arabidopsis thaliana	NP_199919.1	Respiratory burst oxidase-C [Arabidopsis thaliana]	8.0e-38	68%
RefSeq	Populus trichocarpa	XP_002303736.1	predicted protein [Populus trichocarpa]	3.0e-38	70%

Full-Lengther Next Prediction

Fln status: Internal

Fln database: coniferopsida.fasta

Fln subject: D5ABF5

Fln msg: Distance to subject end: 148 aas, your sequence is shorter than subject: 97 - 358

Fln protein: VRLGCTWTRELKNSFAEVCKPPMGGKSGLLRADYMQGKTNPRFPRLLIDGPYGAPAQDYKKYDVLLLVGLGIGATPTISILKDIVNHMKVSEEEGSI

Protein Length: 98

Fln nts: TGTACGTTTGGGTTGTACTTGGACACGAGAACTCAAAAATTCATTTGCAGAGGTATGTAAGCCTCCAATGGGTGGGAAAAGTGGCCTGTTGAGAGCAGATTATATGCAAGGAAAAACCAACCCAAGATTTCCGAGGTTGCTAATCGATGGGCCTTATGGAGCACCAGCACAAGACTATAAAAAGTATGATGTCTTGCTTCTTGTTGGTCTAGGAATCGGAGCCACTCCAACAATCAGCATTCTCAAAGACATTGTCAACCATATGAAAGTATCTGAGGAAGAAGGCAGCATTGC

Fln Alignment:

AllPine_a_c29986___WTRELKNSFAEVCKPPMGGKSGLLRADYMQGKTNPRFPRLLIDGPYGAPAQDYKKYDVLLLVGLGIGATPTISILKDIVNHMKVSEEEGSI
D5ABF5________________WTRELKNSFAEVCEPPMGGKSGLLRADYMQGKNNPRFPRLLIDGPYGAPAQDYKKYDVLLLVGLGIGATPFISILKDIVNHMKVSEEERNI

Back

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain