SustainPineDB

All assemblies
Assembly info
Unigenes
SNPs
SSRs
Descriptions
GOs
ECs
KEGGs
InterPros
miRNAs

Assembly Name: SustainPine v3.0

UniGene Name: sp_v3.0_unigene101268

Length: 218 nt

This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense

UniGene Fasta (sense)

>sp_v3.0_unigene101268
GTTGGTTCCTCTGCTTACCAGTATGAAGGAGCTGCAGCAGAAGATGGTCGGAAACCAAGCATCTTTGACACTTTCACTCACAGGGAAGGGACTAGTCTGGATGGAAGTAATGGAGATGTAGCTGTTGATCAATACCATCGTTACAAGGAGGATATTGACATAATGTCTGCGATGGGAGTAGATGCCTATAGATTTTCAATCTCATGGTAGCTTCAGTA

Ace file of the UniGene sp_v3.0_unigene101268 (antisense)

If you push the Download ace button, you will download an ace file of this UniGene.

To watch this ACE file you will need an ACE viewer program as Tablet:

Go to the Tablet ACE viewer Web

Annotations

Source	Descriptions	Term	Type	e value	Identity
AutoFact	amygdalin hydrolase isoform AH I precursor [Prunus serotina]	-	-	6.0e-22	73%
FL-Next	tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis).	-	-	0.0	68%
Sma3	Beta-glucosidase	-	-	1.051e-31	-

Source	ECs	Term	Type	e value	Identity
Sma3	Prunasin beta-glucosidase.	EC:3.2.1.118	-	7.257e-11	-

Source	KEGGs	Term	Type	e value	Identity
Sma3	Cyanoamino acid metabolism	00460		7.257e-11	%
Sma3	Beta-glucosidase.	EC:3.2.1.21	-	0.0	-

Source	KEGGs	Term	Type	e value	Identity
Sma3	Cyanoamino acid metabolism	00460		0.0	%
Sma3	Starch and sucrose metabolism	00500		0.0	%
Sma3	Phenylpropanoid biosynthesis	00940		0.0	%
Sma3	Biosynthesis of secondary metabolites	01110		0.0	%
Sma3	Beta-D-fucosidase.	EC:3.2.1.38	-	4.705e-07	-

Source	Gene names
Sma3	AH1; AT4g27820; At1g02850; At1g02850/F22D16.15; At1g26560; At1g60260; At2g25630; At2g44480; At4g27830; At5g24540; At5g36890; At5g42260; At5g44640; B1168A08.29-1; B1168A08.29-2; BGL; BGLU1; Bglc-2; F22D16.15; F26K9_180; GSVIVT00003784001; GSVIVT00003795001

Source	GOs	Term	Type	Identity
Sma3	vacuole	GO:0005773	Cellular Component	-
Sma3	peroxisome	GO:0005777	Cellular Component	-
Sma3	plant-type cell wall	GO:0009505	Cellular Component	-
Sma3	chloroplast	GO:0009507	Cellular Component	-
Sma3	apoplast	GO:0048046	Cellular Component	-
Sma3	hydrolase activity, hydrolyzing O-glycosyl compounds	GO:0004553	Molecular Function	-
Sma3	beta-mannosidase activity	GO:0004567	Molecular Function	-
Sma3	beta-glucosidase activity	GO:0008422	Molecular Function	-
Sma3	beta-D-fucosidase activity	GO:0033907	Molecular Function	-
Sma3	cation binding	GO:0043169	Molecular Function	-
Sma3	amygdalin beta-glucosidase activity	GO:0047668	Molecular Function	-
Sma3	prunasin beta-glucosidase activity	GO:0050224	Molecular Function	-
Sma3	raucaffricine beta-glucosidase activity	GO:0050247	Molecular Function	-
Sma3	beta-primeverosidase activity	GO:0050535	Molecular Function	-
Sma3	carbohydrate metabolic process	GO:0005975	Biological Process	-
Sma3	cellulose catabolic process	GO:0030245	Biological Process	-
Sma3	response to other organism	GO:0051707	Biological Process	-

Source	InterPros	Term	Type	Identity
Sma3	Glycoside hydrolase, family 1	IPR001360	-	-
Sma3	Glycoside hydrolase, subgroup, catalytic domain	IPR013781	-	-
Sma3	Glycoside hydrolase, family 1, beta-glucosidase	IPR017736	-	-
Sma3	DNA methylase, C-5 cytosine-specific, active site	IPR018117	-	-
Sma3	Glycoside hydrolase, family 1, active site	IPR018120	-	-

Source	Species	ID	Description	e value	Identity
ATG	Arabidoptis thaliana	AT5G36890.1	BGLU42 beta glucosidase 42 chr5:14542164-14546090 REVERSE LENGTH=490	1.0e-24	65%
RefSeq	Arabidopsis thaliana	NP_001031975.1	beta glucosidase 42 [Arabidopsis thaliana]	1.0e-24	65%
RefSeq	Populus trichocarpa	XP_002336575.1	predicted protein, partial [Populus trichocarpa]	2.0e-26	61%

Full-Lengther Next Prediction

Fln status: Internal

Fln database: coniferopsida.fasta

Fln subject: A9NVG8

Fln msg: Unexpected STOP codon at 3' end. Distance to subject end: 382 aas, your sequence is shorter than subject: 70 - 477

Fln protein: VGSSAYQYEGAAAEDGRKPSIFDTFTHREGTSLDGSNGDVAVDQYHRYKEDIDIMSAMGVDAYRFSISW*

Protein Length: 71

Fln nts: GTTGGTTCCTCTGCTTACCAGTATGAAGGAGCTGCAGCAGAAGATGGTCGGAAACCAAGCATCTTTGACACTTTCACTCACAGGGAAGGGACTAGTCTGGATGGAAGTAATGGAGATGTAGCTGTTGATCAATACCATCGTTACAAGGAGGATATTGACATAATGTCTGCGATGGGAGTAGATGCCTATAGATTTTCAATCTCATGGTAGCTTCAGTA

Fln Alignment:

AllPine_a_c27775___VGSSAYQYEGAAAEDGRKPSIFDTFTHREGTSLDGSNGDVAVDQYHRYKEDIDIMSAMGVDAYRFSISW
A9NVG8________________IATSAYQCEGAAKEGGKGPSIWDSFSRTPGKILDGSNGDVAVDQYHRYKEDVKLMKDMGVDTYRFSISW

Back

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain