UniGene Name: sp_v3.0_unigene101268
Length: 218 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
UniGene Fasta (sense)
|
|---|
| >sp_v3.0_unigene101268
G |
Ace file of the UniGene sp_v3.0_unigene101268 (antisense)
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | amygdalin hydrolase isoform AH I precursor [Prunus serotina] | - | - | 6.0e-22 | 73% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 68% |
| Sma3 | Beta-glucosidase | - | - | 1.051e-31 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Prunasin beta-glucosidase. | EC:3.2.1.118 | - | 7.257e-11 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Cyanoamino acid metabolism | 00460 | 7.257e-11 | % | |
| Sma3 | Beta-glucosidase. | EC:3.2.1.21 | - | 0.0 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Cyanoamino acid metabolism | 00460 | 0.0 | % | |
| Sma3 | Starch and sucrose metabolism | 00500 | 0.0 | % | |
| Sma3 | Phenylpropanoid biosynthesis | 00940 | 0.0 | % | |
| Sma3 | Biosynthesis of secondary metabolites | 01110 | 0.0 | % | |
| Sma3 | Beta-D-fucosidase. | EC:3.2.1.38 | - | 4.705e-07 | - |
| Source | Gene names |
|---|---|
| Sma3 | AH1; AT4g27820; At1g02850; At1g02850/F22D16.15; At1g26560; At1g60260; At2g25630; At2g44480; At4g27830; At5g24540; At5g36890; At5g42260; At5g44640; B1168A08.29-1; B1168A08.29-2; BGL; BGLU1; Bglc-2; F22D16.15; F26K9_180; GSVIVT00003784001; GSVIVT00003795001 |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | vacuole | GO:0005773 | Cellular Component | 0.0 | - |
| Sma3 | peroxisome | GO:0005777 | Cellular Component | 0.0 | - |
| Sma3 | plant-type cell wall | GO:0009505 | Cellular Component | 0.0 | - |
| Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
| Sma3 | apoplast | GO:0048046 | Cellular Component | 0.0 | - |
| Sma3 | hydrolase activity, hydrolyzing O-glycosyl compounds | GO:0004553 | Molecular Function | 0.0 | - |
| Sma3 | beta-mannosidase activity | GO:0004567 | Molecular Function | 0.0 | - |
| Sma3 | beta-glucosidase activity | GO:0008422 | Molecular Function | 0.0 | - |
| Sma3 | beta-D-fucosidase activity | GO:0033907 | Molecular Function | 0.0 | - |
| Sma3 | cation binding | GO:0043169 | Molecular Function | 0.0 | - |
| Sma3 | amygdalin beta-glucosidase activity | GO:0047668 | Molecular Function | 0.0 | - |
| Sma3 | prunasin beta-glucosidase activity | GO:0050224 | Molecular Function | 0.0 | - |
| Sma3 | raucaffricine beta-glucosidase activity | GO:0050247 | Molecular Function | 0.0 | - |
| Sma3 | beta-primeverosidase activity | GO:0050535 | Molecular Function | 0.0 | - |
| Sma3 | carbohydrate metabolic process | GO:0005975 | Biological Process | 0.0 | - |
| Sma3 | cellulose catabolic process | GO:0030245 | Biological Process | 0.0 | - |
| Sma3 | response to other organism | GO:0051707 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Glycoside hydrolase, family 1 | IPR001360 | - | 0.0 | - |
| Sma3 | Glycoside hydrolase, subgroup, catalytic domain | IPR013781 | - | 0.0 | - |
| Sma3 | Glycoside hydrolase, family 1, beta-glucosidase | IPR017736 | - | 0.0 | - |
| Sma3 | DNA methylase, C-5 cytosine-specific, active site | IPR018117 | - | 0.0 | - |
| Sma3 | Glycoside hydrolase, family 1, active site | IPR018120 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT5G36890.1 | BGLU42 beta glucosidase 42 chr5:14542164-14546090 REVERSE LENGTH=490 | 1.0e-24 | 65% |
| RefSeq | Arabidopsis thaliana | NP_001031975.1 | beta glucosidase 42 [Arabidopsis thaliana] | 1.0e-24 | 65% |
| RefSeq | Populus trichocarpa | XP_002336575.1 | predicted protein, partial [Populus trichocarpa] | 2.0e-26 | 61% |
Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: A9NVG8
Fln msg: Unexpected STOP codon at 3' end. Distance to subject end: 382 aas, your sequence is shorter than subject: 70 - 477
Fln protein:
V
Protein Length:
71
Fln nts:
G
Fln Alignment:
AllPine_a_c27775___VGSSAYQYEGAAAEDGRKPSIFDTFTHREGTSLDGSNGDVAVDQYHRYKEDIDIMSAMGVDAYRFSISW
A9NVG8________________IATSAYQCEGAAKEGGKGPSIWDSFSRTPGKILDGSNGDVAVDQYHRYKEDVKLMKDMGVDTYRFSISW

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
UniGene Fasta (sense)