SustainPineDB

All assemblies
Assembly info
Unigenes
SNPs
SSRs
Descriptions
GOs
ECs
KEGGs
InterPros
miRNAs

Assembly Name: SustainPine v3.0

UniGene Name: sp_v3.0_unigene100681

Length: 245 nt

This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense

UniGene Fasta (sense)

>sp_v3.0_unigene100681
ACGACTCTCATGATCCTTGCAGTTTGTGCAGTTATCTCTCTAGTTGTTGAAATTTATAAAGAAGGGTGGCCGAAAGGTGCTTATGATGGTCTTGGCGTTATGTTTAGCATTCTATTAGTTGTCTTTGTAACAGCAACTTGTGATTATCATCAATCATTGCAGTTTAAGGCTTTAGATAGAGAAAAGAAAGCCTGTTGGAAGAGGCGGAAGCATCATCAGCAATGTTATGTGGAGGAATATACATT

Ace file of the UniGene sp_v3.0_unigene100681 (antisense)

If you push the Download ace button, you will download an ace file of this UniGene.

To watch this ACE file you will need an ACE viewer program as Tablet:

Go to the Tablet ACE viewer Web

Annotations

Source	Descriptions	Term	Type	e value	Identity
AutoFact	Calcium-transporting ATPase 1, plasma membrane-type n=4 Tax=BEP clade RepID=ACA1_ORYSJ	-	-	1.0e-19	77%
FL-Next	sp=Calcium-transporting ATPase 1, plasma membrane-type; Oryza sativa subsp. japonica (Rice).	-	-	0.0	77%
Sma3	Autoinhibited calcium ATPase	-	-	3.586e-13	-

Source	ECs	Term	Type	e value	Identity
Sma3	Calcium-transporting ATPase.	EC:3.6.3.8	-	2.028e-35	-

Source	Gene names
Sma3	ACA1; ACA11; ACA2; ACA4; ACA7; At1g27770; At2g22950; At2g41560; At3g57330; At4g37640; B1150F11.11; F19F18.130; F28L5.1; F28O9.180; GSVIVT00009948001; GSVIVT00014954001; GSVIVT00019659001; GSVIVT00028663001; LOC_Os01g71240; LOC_Os03g10640; LOC_Os03g42020;

Source	GOs	Term	Type	Identity
Sma3	plant-type vacuole	GO:0000325	Cellular Component	-
Sma3	vacuole	GO:0005773	Cellular Component	-
Sma3	vacuolar membrane	GO:0005774	Cellular Component	-
Sma3	endoplasmic reticulum	GO:0005783	Cellular Component	-
Sma3	endoplasmic reticulum membrane	GO:0005789	Cellular Component	-
Sma3	plasma membrane	GO:0005886	Cellular Component	-
Sma3	chloroplast	GO:0009507	Cellular Component	-
Sma3	chloroplast inner membrane	GO:0009706	Cellular Component	-
Sma3	membrane	GO:0016020	Cellular Component	-
Sma3	integral to membrane	GO:0016021	Cellular Component	-
Sma3	magnesium ion binding	GO:0000287	Molecular Function	-
Sma3	damaged DNA binding	GO:0003684	Molecular Function	-
Sma3	DNA-directed DNA polymerase activity	GO:0003887	Molecular Function	-
Sma3	calcium channel activity	GO:0005262	Molecular Function	-
Sma3	calcium-transporting ATPase activity	GO:0005388	Molecular Function	-
Sma3	calcium ion binding	GO:0005509	Molecular Function	-
Sma3	calmodulin binding	GO:0005516	Molecular Function	-
Sma3	ATP binding	GO:0005524	Molecular Function	-
Sma3	ATPase activity, coupled to transmembrane movement of ions, phosphorylative mechanism	GO:0015662	Molecular Function	-
Sma3	DNA repair	GO:0006281	Biological Process	-
Sma3	ATP biosynthetic process	GO:0006754	Biological Process	-
Sma3	calcium ion transport	GO:0006816	Biological Process	-
Sma3	response to nematode	GO:0009624	Biological Process	-
Sma3	response to salt stress	GO:0009651	Biological Process	-

Source	InterPros	Term	Type	Identity
Sma3	ATPase, P-type, H+ transporting proton pump	IPR000695	-	-
Sma3	DNA-repair protein, UmuC-like	IPR001126	-	-
Sma3	ATPase, P-type, K/Mg/Cd/Cu/Zn/Na/Ca/Na/H-transporter	IPR001757	-	-
Sma3	ATPase, P-type cation-transporter, N-terminal	IPR004014	-	-
Sma3	Haloacid dehalogenase-like hydrolase	IPR005834	-	-
Sma3	ATPase, P-type cation-transporter, C-terminal	IPR006068	-	-
Sma3	ATPase, P-type cation exchange, alpha subunit	IPR006069	-	-
Sma3	ATPase, P-type, calcium-transporting, PMCA-type	IPR006408	-	-
Sma3	ATPase, P-type, ATPase-associated domain	IPR008250	-	-
Sma3	DNA-repair protein, UmuC-like, N-terminal	IPR017963	-	-
Sma3	ATPase, P-type phosphorylation site	IPR018303	-	-

Source	Species	ID	Description	e value	Identity
ATG	Arabidoptis thaliana	AT1G27770.1	ACA1, PEA1 autoinhibited Ca2+-ATPase 1 chr1:9671912-9676010 REVERSE LENGTH=1020	2.0e-23	74%
RefSeq	Arabidopsis thaliana	NP_564295.1	autoinhibited Ca2+-ATPase 1 [Arabidopsis thaliana]	2.0e-23	74%
RefSeq	Populus trichocarpa	XP_002320033.1	predicted protein [Populus trichocarpa]	3.0e-24	75%

Full-Lengther Next Prediction

Fln status: Internal

Fln database: sp_plants

Fln subject: Q2QMX9

Fln msg: Distance to subject end: 765 aas, your sequence is shorter than subject: 81 - 1020

Fln protein: TTLMILAVCAVISLVVEIYKEGWPKGAYDGLGVMFSILLVVFVTATCDYHQSLQFKALDREKKACWKRRKHHQQCYVEEYT

Protein Length: 82

Fln nts: ACGACTCTCATGATCCTTGCAGTTTGTGCAGTTATCTCTCTAGTTGTTGAAATTTATAAAGAAGGGTGGCCGAAAGGTGCTTATGATGGTCTTGGCGTTATGTTTAGCATTCTATTAGTTGTCTTTGTAACAGCAACTTGTGATTATCATCAATCATTGCAGTTTAAGGCTTTAGATAGAGAAAAGAAAGCCTGTTGGAAGAGGCGGAAGCATCATCAGCAATGTTATGTGGAGGAATATACATT

Fln Alignment:

AllPine_a_c26316___TTLMILAVCAVISLVVEIYKEGWPKGAYDGLGVMFSILLVVFVTATCDYHQSLQFKALDREKK
Q2QMX9________________TTLIILAVCAFVSLVVGIAMEGWPKGAHDGLGIVASILLVVFVTATSDYRQSLQFKDLDKEKK

Back

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain