|
||||||
|
UniGene Name: sp_v3.0_unigene100653
Length: 221 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene100653
T |
|
Ace file of the UniGene sp_v3.0_unigene100653
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | FtsZ-like protein [Nicotiana tabacum] | - | - | 8.0e-19 | 80% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 88% |
| Sma3 | Chloroplast FtsZ-like protein | - | - | 3.687e-08 | - |
| Source | Gene names |
|---|---|
| Sma3 | At5g55280; FTSZ; FtsZ; FtsZ1; GSVIVT00027244001; H1005F08.7; MCO15.23; OSJNBa0087O24.6; Os04g0665400; OsI_17816; OsJ_16530; POPTRDRAFT_642244; RCOM_0547150; ftsZ; ftsZ1-1; ftsz1; |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | cytoplasm | GO:0005737 | Cellular Component | 0.0 | - |
| Sma3 | microtubule | GO:0005874 | Cellular Component | 0.0 | - |
| Sma3 | chloroplast stroma | GO:0009570 | Cellular Component | 0.0 | - |
| Sma3 | protein complex | GO:0043234 | Cellular Component | 0.0 | - |
| Sma3 | GTPase activity | GO:0003924 | Molecular Function | 0.0 | - |
| Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
| Sma3 | GTP binding | GO:0005525 | Molecular Function | 0.0 | - |
| Sma3 | barrier septum assembly | GO:0000917 | Biological Process | 0.0 | - |
| Sma3 | microtubule-based process | GO:0007017 | Biological Process | 0.0 | - |
| Sma3 | cell cycle | GO:0007049 | Biological Process | 0.0 | - |
| Sma3 | chloroplast fission | GO:0010020 | Biological Process | 0.0 | - |
| Sma3 | protein polymerization | GO:0051258 | Biological Process | 0.0 | - |
| Sma3 | cell division | GO:0051301 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Cell division protein FtsZ | IPR000158 | - | 0.0 | - |
| Sma3 | Tubulin/FtsZ, GTPase domain | IPR003008 | - | 0.0 | - |
| Sma3 | Tubulin, conserved site | IPR017975 | - | 0.0 | - |
| Sma3 | Tubulin/FtsZ, 2-layer sandwich domain | IPR018316 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT5G55280.1 | FTSZ1-1, ATFTSZ1-1, CPFTSZ homolog of bacterial cytokinesis Z-ring protein FTSZ 1-1 chr5:22420740-22422527 REVERSE LENGTH=433 | 3.0e-19 | 76% |
| RefSeq | Arabidopsis thaliana | NP_200339.1 | cell division protein ftsZ-like protein [Arabidopsis thaliana] | 4.0e-19 | 76% |
| RefSeq | Populus trichocarpa | XP_002300342.1 | predicted protein [Populus trichocarpa] | 8.0e-20 | 76% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: C0PSV8
Fln msg: Overlapping hits, possible frame ERROR between 106 and 103, Unexpected STOP codon at 3' end. Distance to subject end: 256 aas, your sequence is shorter than subject: 73 - 439
Fln protein:
L
Protein Length:
74
Fln nts:
T
Fln Alignment:
AllPine_a_c26248___LHGVEFYAMYTDAQALLQSAADNPVQIGEQLxxxxGTGGNPELGEQAAEESKEAIVASLKESDLVFITA
C0PSV8________________LHGVEFYAINTDAQALLQSATENPVQIGEQLxxxxGTGGNPELGEQAAEESKEAIVESLKESDLVFITA
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
