|
||||||
|
UniGene Name: sp_v3.0_unigene100634
Length: 211 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene100634
A |
|
Ace file of the UniGene sp_v3.0_unigene100634
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | callose synthase 5 [Arabidopsis thaliana] sp|Q3B724.1|CALS5_ARATH RecName: Full=Callose synthase 5; AltName: Full=1,3-beta-glucan synthase; AltName: Full=Protein GLUCAN SYNTHASE-LIKE 2; AltName: Full=Protein LESS ADHERENT POLLEN 1 gb|AAR00322.1| LAP1 [Ara | - | - | 2.0e-25 | 80% |
| FL-Next | sp=Callose synthase 5; Arabidopsis thaliana (Mouse-ear cress). | - | - | 0.0 | 80% |
| Sma3 | 1,3-beta-glucan synthase | - | - | 1.5078e-42 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | 1,3-beta-glucan synthase. | EC:2.4.1.34 | - | 0.0 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Starch and sucrose metabolism | 00500 | 0.0 | % |
| Source | Gene names |
|---|---|
| Sma3 | At1g05570; At1g06490; At2g13680; At2g31960; At2g36850; At3g07160; At3g14570; At3g59100; At4g03550; At4g04970; At5g13000; At5g36870; CALS1; CALS10; CALS11; CALS12; CALS2; CALS3; CALS4; CALS5; CALS6; CALS7; CALS8; CALS9; CFL1; CalS3; CalS9; F12K11.17; F13J1 |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | 1,3-beta-D-glucan synthase complex | GO:0000148 | Cellular Component | 0.0 | - |
| Sma3 | cell plate | GO:0009504 | Cellular Component | 0.0 | - |
| Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
| Sma3 | RNA binding | GO:0003723 | Molecular Function | 0.0 | - |
| Sma3 | 1,3-beta-D-glucan synthase activity | GO:0003843 | Molecular Function | 0.0 | - |
| Sma3 | RNA-directed DNA polymerase activity | GO:0003964 | Molecular Function | 0.0 | - |
| Sma3 | (1->3)-beta-D-glucan biosynthetic process | GO:0006075 | Biological Process | 0.0 | - |
| Sma3 | RNA-dependent DNA replication | GO:0006278 | Biological Process | 0.0 | - |
| Sma3 | cellular cell wall organization | GO:0007047 | Biological Process | 0.0 | - |
| Sma3 | regulation of cell shape | GO:0008360 | Biological Process | 0.0 | - |
| Sma3 | microsporogenesis | GO:0009556 | Biological Process | 0.0 | - |
| Sma3 | response to fungus | GO:0009620 | Biological Process | 0.0 | - |
| Sma3 | salicylic acid mediated signaling pathway | GO:0009863 | Biological Process | 0.0 | - |
| Sma3 | defense response signaling pathway, resistance gene-dependent | GO:0009870 | Biological Process | 0.0 | - |
| Sma3 | leaf morphogenesis | GO:0009965 | Biological Process | 0.0 | - |
| Sma3 | pollen wall assembly | GO:0010208 | Biological Process | 0.0 | - |
| Sma3 | developmental growth | GO:0048589 | Biological Process | 0.0 | - |
| Sma3 | defense response by callose deposition | GO:0052542 | Biological Process | 0.0 | - |
| Sma3 | callose deposition in cell wall | GO:0052543 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Reverse transcriptase | IPR000477 | - | 0.0 | - |
| Sma3 | Peptidase M14, carboxypeptidase A | IPR000834 | - | 0.0 | - |
| Sma3 | F-box domain, cyclin-like | IPR001810 | - | 0.0 | - |
| Sma3 | Pentatricopeptide repeat | IPR002885 | - | 0.0 | - |
| Sma3 | Glycosyl transferase, family 48 | IPR003440 | - | 0.0 | - |
| Sma3 | K Homology domain | IPR004087 | - | 0.0 | - |
| Sma3 | K Homology domain, type 1 | IPR004088 | - | 0.0 | - |
| Sma3 | IPR015706 | - | 0.0 | - | |
| Sma3 | ABC transporter, conserved site | IPR017871 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT2G13680.1 | CALS5, GLS2, ATGSL02 callose synthase 5 chr2:5695124-5706134 FORWARD LENGTH=1923 | 2.0e-31 | 80% |
| RefSeq | Arabidopsis thaliana | NP_849953.2 | callose synthase 5 [Arabidopsis thaliana] | 2.0e-31 | 80% |
| RefSeq | Populus trichocarpa | XP_002304888.1 | predicted protein [Populus trichocarpa] | 2.0e-30 | 80% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: sp_plants
Fln subject: Q3B724
Fln msg: Distance to subject end: 828 aas, your sequence is shorter than subject: 70 - 1923
Fln protein:
R
Protein Length:
71
Fln nts:
A
Fln Alignment:
AllPine_a_c26199___RLHLLLSVMESAMDVPANLEARRRIAFFTNSLFMDMPNAPKVRNMLSFSVLTPYYKEEVLYSLHELQLEN
Q3B724________________RLHLLLTVKESAMDVPTNLEAQRRIAFFTNSLFMDMPRAPRVRNMLSFSVLTPYYSEETVYSKNDLEMEN
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
