UniGene Name: sp_v3.0_unigene100017
Length: 179 nt
UniGene Fasta |
---|
>sp_v3.0_unigene100017
A |
Ace file of the UniGene sp_v3.0_unigene100017 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Unassigned protein | - | - | 0.0 | - |
FL-Next | tr=Putative uncharacterized protein; Vitis vinifera (Grape). | - | - | 0.0 | 71% |
Sma3 | Unconventional myosin heavy chain | - | - | 1.357e-07 | - |
Source | Gene names |
---|---|
Sma3 | 41C02.1; At5g20490; At5g43900; GSVIVT00007440001; GSVIVT00027091001; GSVIVT00027094001; GSVIVT00034148001; LOC_Os03g48140; MYO1; Ntmy170; OSJNBb0024N19.13; Os06g0488200; OsI_13067; OsI_23028; OsJ_12150; OsJ_21402; P0583E12.11; PCM3; PHYPADRAFT_189333; PHY |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | cytoplasm | GO:0005737 | Cellular Component | 0.0 | - |
Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
Sma3 | myosin complex | GO:0016459 | Cellular Component | 0.0 | - |
Sma3 | motor activity | GO:0003774 | Molecular Function | 0.0 | - |
Sma3 | actin binding | GO:0003779 | Molecular Function | 0.0 | - |
Sma3 | protein serine/threonine kinase activity | GO:0004674 | Molecular Function | 0.0 | - |
Sma3 | protein tyrosine kinase activity | GO:0004713 | Molecular Function | 0.0 | - |
Sma3 | signal transducer activity | GO:0004871 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | actin filament binding | GO:0051015 | Molecular Function | 0.0 | - |
Sma3 | protein phosphorylation | GO:0006468 | Biological Process | 0.0 | - |
Sma3 | signal transduction | GO:0007165 | Biological Process | 0.0 | - |
Sma3 | actin filament-based movement | GO:0030048 | Biological Process | 0.0 | - |
Sma3 | keratinization | GO:0031424 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | IQ motif, EF-hand binding site | IPR000048 | - | 0.0 | - |
Sma3 | Ribosomal protein S7 | IPR000235 | - | 0.0 | - |
Sma3 | Involucrin repeat | IPR000354 | - | 0.0 | - |
Sma3 | Protein kinase, catalytic domain | IPR000719 | - | 0.0 | - |
Sma3 | Serine-threonine/tyrosine-protein kinase catalytic domain | IPR001245 | - | 0.0 | - |
Sma3 | Myosin head, motor domain | IPR001609 | - | 0.0 | - |
Sma3 | Dilute | IPR002710 | - | 0.0 | - |
Sma3 | Immunoglobulin/major histocompatibility complex, conserved site | IPR003006 | - | 0.0 | - |
Sma3 | HAMP linker domain | IPR003660 | - | 0.0 | - |
Sma3 | Myosin, N-terminal, SH3-like | IPR004009 | - | 0.0 | - |
Sma3 | Serine/threonine-protein kinase, active site | IPR008271 | - | 0.0 | - |
Sma3 | TonB box, conserved site | IPR010916 | - | 0.0 | - |
Sma3 | Protein kinase, ATP binding site | IPR017441 | - | 0.0 | - |
Sma3 | IPR017442 | - | 0.0 | - | |
Sma3 | Dil domain | IPR018444 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT1G08730.1 | XIC, ATXIC Myosin family protein with Dil domain chr1:2779963-2788325 FORWARD LENGTH=1538 | 2.0e-13 | 73% |
RefSeq | Arabidopsis thaliana | NP_172349.2 | myosin motor domain-containing protein and DIL domain-containing protein [Arabidopsis thaliana] | 2.0e-13 | 73% |
RefSeq | Populus trichocarpa | XP_002309201.1 | predicted protein [Populus trichocarpa] | 6.0e-14 | 76% |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: tr_plants
Fln subject: D7U8K4
Fln msg: Unexpected stop codon in the beginning of your sequence, Distance to subject end: 17 aas, your sequence is shorter than subject: 59 - 99
Fln protein:
N
Protein Length:
60
Fln nts:
A
Fln Alignment:
AllPine_a_c24432___VIASMKMLMAEDSNDAHGNSFLLDDDLSIPFSVDDISKSMQE
D7U8K4________________VISSMRVMMTEDSNNVVSNSFLLDDDLSIPFTVDDISKTMQQ
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain