UniGene Name: sp_v3.0_unigene99099
Length: 217 nt
![]() |
---|
>sp_v3.0_unigene99099
C |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | DNA topoisomerase 2 n=3 Tax=Selaginella moellendorffii RepID=D8RNR7_SELML | - | - | 3.0e-28 | 84% |
FL-Next | sp=DNA topoisomerase 2; Pisum sativum (Garden pea). | - | - | 0.0 | 70% |
Sma3 | DNA topoisomerase 2 | - | - | 0.0 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | DNA topoisomerase (ATP-hydrolyzing). | EC:5.99.1.3 | - | 0.0 | - |
Source | Gene names |
---|---|
Sma3 | At3g23890; CHLREDRAFT_38019; F14O13.7; GSVIVT00028763001; MICPUCDRAFT_46870; MICPUN_58377; Md49N23_TopII.010; OSTLU_41836; Os02g0699700; OsI_08583; OsJ_08043; Ot13g00110; P0459B01.29; PHYPADRAFT_120620; PHYPADRAFT_134247; POPTRDRAFT_557797; POPTRDRAFT_706 |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
Sma3 | chromosome | GO:0005694 | Cellular Component | 0.0 | - |
Sma3 | DNA topoisomerase (ATP-hydrolyzing) activity | GO:0003918 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | DNA topological change | GO:0006265 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | DNA topoisomerase, type IIA | IPR001241 | - | 0.0 | - |
Sma3 | DNA topoisomerase, type IIA, subunit A/C-terminal | IPR002205 | - | 0.0 | - |
Sma3 | ATPase-like, ATP-binding domain | IPR003594 | - | 0.0 | - |
Sma3 | DNA topoisomerase, type IIA, subunit B, domain 2 | IPR013506 | - | 0.0 | - |
Sma3 | DNA topoisomerase, type IIA, subunit A, alpha-helical | IPR013757 | - | 0.0 | - |
Sma3 | DNA topoisomerase, type IIA, subunit A/ C-terminal, alpha-beta | IPR013758 | - | 0.0 | - |
Sma3 | DNA topoisomerase, type IIA, subunit B/N-terminal, alpha-beta | IPR013759 | - | 0.0 | - |
Sma3 | Ribosomal protein S5 domain 2-type fold, subgroup | IPR014721 | - | 0.0 | - |
Sma3 | DNA topoisomerase, type IIA, conserved site | IPR018522 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT3G23890.1 | TOPII, ATTOPII topoisomerase II chr3:8624931-8631106 FORWARD LENGTH=1473 | 4.0e-26 | 70% |
RefSeq | Arabidopsis thaliana | NP_001118686.1 | DNA topoisomerase 2 [Arabidopsis thaliana] | 5.0e-26 | 70% |
RefSeq | Populus trichocarpa | XP_002298421.1 | predicted protein [Populus trichocarpa] | 1.0e-24 | 66% |
![]() |
---|
Fln status: Internal
Fln database: sp_plants
Fln subject: O24308
Fln msg: Distance to subject end: 1022 aas, your sequence is shorter than subject: 71 - 1462
Fln protein:
L
Protein Length:
72
Fln nts:
C
Fln Alignment:
AllPine_a_c21057___LTTRQNSFGSKCELSQELLKKVAKCGVVENILSWADFKQSKDLKKTDGTKRQRLTGITKLDDANDAGGRNS
O24308_______________LTTRQASFGSKCDVPESMLKDVEKSGIVDTLLSWADFKQSKDLKKTDGTKTQRLRG-CKAEDANEAGGRNS
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain