SustainPineDB

All assemblies
Assembly info
Unigenes
SNPs
SSRs
Descriptions
GOs
ECs
KEGGs
InterPros
miRNAs

Assembly Name: SustainPine v3.0

UniGene Name: sp_v3.0_unigene98685

Length: 454 nt

UniGene Fasta

>sp_v3.0_unigene98685
ATGGGGGGAGTGTAGTTGGAAAACATACAAGGGGACCATTCCCCTCAAGTGAAACTCAAATTACCGATATTCTTCAATTGGTCCATTTTGATCTATCTTGTGTGTTGCCTGTGACATCTTTGGGAGGATATTTGTACTATGCTATTTTTGTGGATGACTTCTCTCGCAAAACATGGATCTATTTCTTAAAGGAGAAGATGAAGTGTTCAAATGGTTTTGCTCTTTCAAAGCCTTGGTCGAGAATCAAATAGGGAAGAAGATCAAAATATTGAGGACCGATAATGGTACTGAATATGAGTCAAATGAATTCAATGACTATTGTAGAGAAGTTGGCATTAAGAGGGAGACCACTACTGTATATGCTCCCGAGCAAAATGGCGTTTCCAAAAGGAAGAATCGTACTATCATAGAAGTCACTCGTGCCATGCTTCATGACCAAGGTCTTCCGAAGTTC

Ace file of the UniGene sp_v3.0_unigene98685

If you push the Download ace button, you will download an ace file of this UniGene.

To watch this ACE file you will need an ACE viewer program as Tablet:

Go to the Tablet ACE viewer Web

Annotations

Source	Descriptions	Term	Type	e value	Identity
AutoFact	Integrase n=1 Tax=Boechera divaricarpa RepID=B6REL8_9BRAS	-	-	8.0e-32	51%
FL-Next	tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis).	-	-	0.0	50%
Sma3	Retrotransposon protein, putative, Ty1-copia subclass	-	-	3.741e-24	-

Source	Gene names
Sma3	AT4g04280; AT4g04380; AT4g10460; AT4g21360; At2g15700; At2g21460; B1110B01.13; F11I4_21; F28L22.3; F7L13.40; F9K21.100; GSVIVT00032582001; LOC_Os03g20690; LOC_Os03g26290; LOC_Os03g30450; LOC_Os03g31134; LOC_Os03g31620; LOC_Os03g41000; LOC_Os03g49910; LOC_

Source	GOs	Term	Type	Identity
Sma3	intracellular	GO:0005622	Cellular Component	-
Sma3	ribosome	GO:0005840	Cellular Component	-
Sma3	membrane	GO:0016020	Cellular Component	-
Sma3	intrinsic to membrane	GO:0031224	Cellular Component	-
Sma3	nucleotide binding	GO:0000166	Molecular Function	-
Sma3	DNA binding	GO:0003677	Molecular Function	-
Sma3	catalytic activity	GO:0003824	Molecular Function	-
Sma3	RNA-directed DNA polymerase activity	GO:0003964	Molecular Function	-
Sma3	aspartic-type endopeptidase activity	GO:0004190	Molecular Function	-
Sma3	endonuclease activity	GO:0004519	Molecular Function	-
Sma3	peroxidase activity	GO:0004601	Molecular Function	-
Sma3	transmembrane signaling receptor activity	GO:0004888	Molecular Function	-
Sma3	protein binding	GO:0005515	Molecular Function	-
Sma3	ATP binding	GO:0005524	Molecular Function	-
Sma3	zinc ion binding	GO:0008270	Molecular Function	-
Sma3	potassium ion transmembrane transporter activity	GO:0015079	Molecular Function	-
Sma3	nucleoside-triphosphatase activity	GO:0017111	Molecular Function	-
Sma3	heme binding	GO:0020037	Molecular Function	-
Sma3	carbohydrate binding	GO:0030246	Molecular Function	-
Sma3	potassium ion transport	GO:0006813	Biological Process	-
Sma3	apoptotic process	GO:0006915	Biological Process	-
Sma3	response to oxidative stress	GO:0006979	Biological Process	-
Sma3	signal transduction	GO:0007165	Biological Process	-
Sma3	DNA integration	GO:0015074	Biological Process	-
Sma3	transposition	GO:0032196	Biological Process	-
Sma3	innate immune response	GO:0045087	Biological Process	-

Source	InterPros	Term	Type	Identity
Sma3	Toll/interleukin-1 receptor homology (TIR) domain	IPR000157	-	-
Sma3	Peptidase S8/S53, subtilisin/kexin/sedolisin	IPR000209	-	-
Sma3	BRCT domain	IPR001357	-	-
Sma3	Integrase, catalytic core	IPR001584	-	-
Sma3	Leucine-rich repeat	IPR001611	-	-
Sma3	Zinc finger, CCHC-type	IPR001878	-	-
Sma3	Haem peroxidase, plant/fungal/bacterial	IPR002016	-	-
Sma3	NB-ARC	IPR002182	-	-
Sma3	Short-chain dehydrogenase/reductase SDR	IPR002198	-	-
Sma3	AAA+ ATPase domain	IPR003593	-	-
Sma3	K+ potassium transporter	IPR003855	-	-
Sma3	Retrotransposon gag protein	IPR005162	-	-
Sma3	Rhamnogalacturonate lyase	IPR010325	-	-
Sma3	Leucine-rich repeat 3	IPR011713	-	-
Sma3	EGF-like region, conserved site	IPR013032	-	-
Sma3		IPR013084	-	-
Sma3	Reverse transcriptase, RNA-dependent DNA polymerase	IPR013103	-	-
Sma3	ABC-2 type transporter	IPR013525	-	-
Sma3	Acyl-CoA N-acyltransferase	IPR016181	-	-
Sma3	Peptidase A2A, retrovirus RVP subgroup	IPR018061	-	-

Full-Lengther Next Prediction

Fln status: Internal

Fln database: coniferopsida.fasta

Fln subject: B8LKX7

Fln msg: Overlapping hits, possible frame ERROR between 197 and 182, Distance to subject end: 145 aas, your sequence is shorter than subject: 151 - 407

Fln protein: GGSVVGKHTRGPFPSSETQITDILQLVHFDLSCVLPVTSLGGYLYYAIFVDDFSRKTWIxxxxxxxEVFKWFCSFKALVENQIGKKIKILRTDNGTEYESNEFNDYCREVGIKRETTTVYAPEQNGVSKRKNRTIIEVTRAMLHDQGLPKF

Protein Length: 152

Fln nts: ATGGGGGGAGTGTAGTTGGAAAACATACAAGGGGACCATTCCCCTCAAGTGAAACTCAAATTACCGATATTCTTCAATTGGTCCATTTTGATCTATCTTGTGTGTTGCCTGTGACATCTTTGGGAGGATATTTGTACTATGCTATTTTTGTGGATGACTTCTCTCGCAAAACATGGATCxxxxxxxxxxxxxxxxxxxxxGAAGTGTTCAAATGGTTTTGCTCTTTCAAAGCCTTGGTCGAGAATCAAATAGGGAAGAAGATCAAAATATTGAGGACCGATAATGGTACTGAATATGAGTCAAATGAATTCAATGACTATTGTAGAGAAGTTGGCATTAAGAGGGAGACCACTACTGTATATGCTCCCGAGCAAAATGGCGTTTCCAAAAGGAAGAATCGTACTATCATAGAAGTCACTCGTGCCATGCTTCATGACCAAGGTCTTCCGAAGTTC

Fln Alignment:

AllPine_a_c20116___LQLVHFDLSCVLPVTSLGGYLYYAIFVDDFSRKTWIYxxxxxDEVFKWFCSFKALVENQIGKKIKILRTDNGTEYESNEFNDYCREVGIKRETTTVYAPEQNGVSKRKNRTIIEVTRAMLHDQGL-PKF
B8LKX7_______________LHLVHSDLMGPLEHPSISGSRYVLTFIDDYSRRIWVYxxxxxDEVFEKFKEFKAFVEKQSGKSIKILRTDNGKEYVNKEFDHYCKYNGIKREHTVPYTPQQNGVAERKNRTLMEMARCMLHARNMDPKF

SNPs (tot: 33)

Position	A %	C %	G %	T %	Probability
17	33	33		33	0.997752
22	66		33		0.997452
29		66		33	0.997452
54	66		33		0.997452
59	66		33		0.997454
62		33	33	33	0.997753
63		33		66	0.997452
66		66		33	0.997452
84		66		33	0.997452
99			33	66	0.997452
100	33		33	33	0.997753
112	33		66		0.997467
114	33		66		0.997467
126	66			33	0.997452
138		66		33	0.997452
162		66		33	0.997476
166		66		33	0.997476
207	33		66		0.997452
213	66		33		0.997452
220		33		66	0.997453
240		66		33	0.997452
241	33		66		0.997476
242	66		33		0.997476
243	33		66		0.997452
247		66		33	0.997464
251		33		66	0.997452
278		66		33	0.997452
288	33		33	33	0.997752
291			33	66	0.997452
302	33	66			0.997452
303	66			33	0.997476
304	66			33	0.997476
315	33	33		33	0.997753

Back

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain