UniGene Name: sp_v3.0_unigene97446
Length: 228 nt
![]() |
---|
>sp_v3.0_unigene97446
A |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Aminophospholipid ATPase n=1 Tax=Populus trichocarpa RepID=B9GK47_POPTR | - | - | 2.0e-23 | 69% |
FL-Next | sp=Putative phospholipid-transporting ATPase 4; Arabidopsis thaliana (Mouse-ear cress). | - | - | 0.0 | 66% |
Sma3 | Aminophospholipid ATPase | - | - | 2.078e-15 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Phospholipid-translocating ATPase. | EC:3.6.3.1 | - | 1.411e-34 | - |
Source | Gene names |
---|---|
Sma3 | ALA10; ALA11; ALA12; ALA4; ALA5; ALA6; ALA7; ALA8; At1g13210; At1g17500; At1g26130; At1g54280; At1g72700; At3g13900; At3g25610; At3g27870; F14G11.10; F1L3.21; F20D21.10; F28B23.19; F28P22.11; F3F19.24; GSVIVT00017595001; GSVIVT00020729001; GSVIVT000302420 |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
Sma3 | chloroplast envelope | GO:0009941 | Cellular Component | 0.0 | - |
Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
Sma3 | magnesium ion binding | GO:0000287 | Molecular Function | 0.0 | - |
Sma3 | phospholipid-translocating ATPase activity | GO:0004012 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | ATPase activity, coupled to transmembrane movement of ions, phosphorylative mechanism | GO:0015662 | Molecular Function | 0.0 | - |
Sma3 | ATP biosynthetic process | GO:0006754 | Biological Process | 0.0 | - |
Sma3 | phospholipid transport | GO:0015914 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | ATPase, P-type, K/Mg/Cd/Cu/Zn/Na/Ca/Na/H-transporter | IPR001757 | - | 0.0 | - |
Sma3 | Haloacid dehalogenase-like hydrolase | IPR005834 | - | 0.0 | - |
Sma3 | ATPase, P-type, phospholipid-translocating, flippase | IPR006539 | - | 0.0 | - |
Sma3 | ATPase, P-type, ATPase-associated domain | IPR008250 | - | 0.0 | - |
Sma3 | HAD superfamily hydrolase-like, type 3 | IPR013200 | - | 0.0 | - |
Sma3 | ATPase, P-type phosphorylation site | IPR018303 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT1G17500.1 | ATPase E1-E2 type family protein / haloacid dehalogenase-like hydrolase family protein chr1:6018757-6023201 FORWARD LENGTH=1216 | 4.0e-22 | 77% |
RefSeq | Arabidopsis thaliana | NP_173193.2 | phospholipid-translocating ATPase [Arabidopsis thaliana] | 5.0e-22 | 77% |
RefSeq | Populus trichocarpa | XP_002297933.1 | aminophospholipid ATPase [Populus trichocarpa] | 9.0e-26 | 69% |
![]() |
---|
Fln status: Internal
Fln database: sp_plants
Fln subject: Q9LNQ4
Fln msg: Overlapping hits, possible frame ERROR between 122 and 80, Distance to subject end: 243 aas, your sequence is shorter than subject: 75 - 1216
Fln protein:
C
Protein Length:
76
Fln nts:
A
Fln Alignment:
AllPine_a_c17801___SIAQFRFLERLLVVHGHWCYKRLDLxxxxxxxxxxxxxxTLFYFEAYTSFSGQPIYDDWYMLLFNVILTSLPVI
Q9LNQ4_______________SIAQFRFLERLLVVHGHWCYKRIAQxxxxxxxxxxxxxxTLFYFEAFTGFSGQSVYNDYYLLLFNVVLTSLPVI
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain