|
||||||
|
UniGene Name: sp_v3.0_unigene96459
Length: 223 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene96459
A |
|
Ace file of the UniGene sp_v3.0_unigene96459
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | AMP deaminase [Arabidopsis thaliana] ref|NP_850294.1| AMP deaminase [Arabidopsis thaliana] sp|O80452.2|AMPD_ARATH RecName: Full=AMP deaminase; Short=AtAMPD; AltName: Full=Protein EMBRYONIC FACTOR 1 gb|AAL07150.1| putative AMP deaminase [Arabidopsis thalia | - | - | 4.0e-22 | 77% |
| FL-Next | sp=AMP deaminase; Arabidopsis thaliana (Mouse-ear cress). | - | - | 0.0 | 87% |
| Sma3 | AMP deaminase, putative | - | - | 6.985e-09 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | AMP deaminase. | EC:3.5.4.6 | - | 3.903e-21 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Purine metabolism | 00230 | 3.903e-21 | % | |
| Sma3 | Biosynthesis of plant hormones | 01070 | 3.903e-21 | % | |
| Sma3 | Metabolic pathways | 01100 | 3.903e-21 | % | |
| Sma3 | Biosynthesis of secondary metabolites | 01110 | 3.903e-21 | % |
| Source | Gene names |
|---|---|
| Sma3 | AMPD; AT2G38280; At2g38280; CHLREDRAFT_102200; F16M14.21; FAC1; GSVIVT00028972001; GSVIVT00038865001; LOC_Os07g49270; MICPUCDRAFT_27810; MICPUN_98107; OSJNBb0052F16.15; OSTLU_35795; Os05g0349200; Os07g0693500; OsI_19555; OsI_27440; Ot02g06910; P0034A04.12 |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | microsome | GO:0005792 | Cellular Component | 0.0 | - |
| Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
| Sma3 | AMP deaminase activity | GO:0003876 | Molecular Function | 0.0 | - |
| Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
| Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
| Sma3 | zinc ion binding | GO:0008270 | Molecular Function | 0.0 | - |
| Sma3 | deaminase activity | GO:0019239 | Molecular Function | 0.0 | - |
| Sma3 | purine ribonucleoside monophosphate biosynthetic process | GO:0009168 | Biological Process | 0.0 | - |
| Sma3 | embryo development ending in seed dormancy | GO:0009793 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Adenosine/AMP deaminase domain | IPR001365 | - | 0.0 | - |
| Sma3 | AMP deaminase | IPR006329 | - | 0.0 | - |
| Sma3 | Adenosine/AMP deaminase active site | IPR006650 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT2G38280.1 | FAC1, ATAMPD AMP deaminase, putative / myoadenylate deaminase, putative chr2:16033767-16038793 REVERSE LENGTH=839 | 6.0e-28 | 87% |
| RefSeq | Arabidopsis thaliana | NP_850294.1 | AMP deaminase [Arabidopsis thaliana] | 8.0e-28 | 87% |
| RefSeq | Populus trichocarpa | XP_002309149.1 | predicted protein [Populus trichocarpa] | 6.0e-30 | 89% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: sp_plants
Fln subject: O80452
Fln msg: Distance to subject end: 116 aas, your sequence is shorter than subject: 73 - 839
Fln protein:
G
Protein Length:
74
Fln nts:
A
Fln Alignment:
AllPine_a_c15408___RPHSGESGDIDHLAATFLLAHNIAHGNNLRKSPXXXXXXXXXXIGLAMSPLSNNSLFLDYHRNPFP
O80452_______________RPHSGEAGDIDHLAATFLTCHSIAHGINLRKSPVLQYLYYLAQIGLAMSPLSNNSLFLDYHRNPFP
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
