SustainPineDB

All assemblies
Assembly info
Unigenes
SNPs
SSRs
Descriptions
GOs
ECs
KEGGs
InterPros
miRNAs

Assembly Name: SustainPine v3.0

UniGene Name: sp_v3.0_unigene95222

Length: 341 nt

UniGene Fasta

>sp_v3.0_unigene95222
CTCAAGCCATAGCAAGACCTCAAGTATTTTGCAATTGGTTCACTTTGACATATTGGTATGATGCCTGTGAACTCTTTGGGAGGATATTTATATTATCTCACTTTTACAGATGATTATTCTCGCAAGACTTGGATATACTTCTTGAAAAAGAAGGATGAAGTGTTCTCTTGGTTCCGTCACTTCAAAGCCTTGATCGAGAATCAAACCGAGAAGAAGATCAAGATCTTAAGGACTGATAATGGGACTGAGTATGAATCCAATGAGTTCCATGACTTTTGCAAAGATGCTGGCATTAAGAGGGAGACCACAACACCTCCATCCTGAGCAGAATGGTTTACATT

Ace file of the UniGene sp_v3.0_unigene95222

If you push the Download ace button, you will download an ace file of this UniGene.

To watch this ACE file you will need an ACE viewer program as Tablet:

Go to the Tablet ACE viewer Web

Annotations

Source	Descriptions	Term	Type	e value	Identity
AutoFact	Putative gag-pol polyprotein, identical n=1 Tax=Solanum demissum RepID=Q6L3N8_SOLDE	-	-	4.0e-22	57%
FL-Next	tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis).	-	-	0.0	57%
Sma3	Retrotransposon protein, putative, Ty1-copia subclass	-	-	3.02e-13	-

Source	Gene names
Sma3	AT4g10460; AT4g21360; At2g13930; At2g15700; At2g21460; F7L13.40; GSVIVT00019821001; LOC_Os03g27910; LOC_Os03g46450; LOC_Os10g01450; LOC_Os10g18420; LOC_Os10g34120; LOC_Os11g05840; LOC_Os11g17390; LOC_Os12g01780; LOC_Os12g23320; LOC_Os12g31920; LOC_Os12g34

Source	GOs	Term	Type	Identity
Sma3	phosphopyruvate hydratase complex	GO:0000015	Cellular Component	-
Sma3	intracellular	GO:0005622	Cellular Component	-
Sma3	nucleus	GO:0005634	Cellular Component	-
Sma3	DNA binding	GO:0003677	Molecular Function	-
Sma3	sequence-specific DNA binding transcription factor activity	GO:0003700	Molecular Function	-
Sma3	RNA-directed DNA polymerase activity	GO:0003964	Molecular Function	-
Sma3	dihydrofolate reductase activity	GO:0004146	Molecular Function	-
Sma3	aspartic-type endopeptidase activity	GO:0004190	Molecular Function	-
Sma3	endonuclease activity	GO:0004519	Molecular Function	-
Sma3	exonuclease activity	GO:0004527	Molecular Function	-
Sma3	phosphopyruvate hydratase activity	GO:0004634	Molecular Function	-
Sma3	protein binding	GO:0005515	Molecular Function	-
Sma3	zinc ion binding	GO:0008270	Molecular Function	-
Sma3	NADP binding	GO:0050661	Molecular Function	-
Sma3	glycolysis	GO:0006096	Biological Process	-
Sma3	regulation of transcription, DNA-dependent	GO:0006355	Biological Process	-
Sma3	glycine biosynthetic process	GO:0006545	Biological Process	-
Sma3	nucleotide biosynthetic process	GO:0009165	Biological Process	-
Sma3	DNA integration	GO:0015074	Biological Process	-
Sma3	transposition	GO:0032196	Biological Process	-

Source	InterPros	Term	Type	Identity
Sma3	Peptidase, cysteine peptidase active site	IPR000169	-	-
Sma3	Peptidase S8/S53, subtilisin/kexin/sedolisin	IPR000209	-	-
Sma3	Enolase	IPR000941	-	-
Sma3	CCAAT-binding transcription factor, subunit B	IPR001289	-	-
Sma3	Integrase, catalytic core	IPR001584	-	-
Sma3	Leucine-rich repeat	IPR001611	-	-
Sma3	Dihydrofolate reductase domain	IPR001796	-	-
Sma3	F-box domain, cyclin-like	IPR001810	-	-
Sma3	Pleckstrin homology domain	IPR001849	-	-
Sma3	Zinc finger, CCHC-type	IPR001878	-	-
Sma3	DNA methylase, N-6 adenine-specific, conserved site	IPR002052	-	-
Sma3	Short-chain dehydrogenase/reductase SDR	IPR002198	-	-
Sma3	Putative 5-3 exonuclease	IPR004859	-	-
Sma3	Zinc finger, PMZ-type	IPR006564	-	-
Sma3	Zinc finger, SWIM-type	IPR007527	-	-
Sma3	Dihydrofolate reductase	IPR012259	-	-
Sma3		IPR013084	-	-
Sma3	Reverse transcriptase, RNA-dependent DNA polymerase	IPR013103	-	-
Sma3	Leucine-rich repeat-containing N-terminal, type 2	IPR013210	-	-
Sma3	Protein kinase, ATP binding site	IPR017441	-	-
Sma3	F-box associated interaction domain	IPR017451	-	-
Sma3	Peptidase A2A, retrovirus RVP subgroup	IPR018061	-	-

Full-Lengther Next Prediction

Fln status: Internal

Fln database: coniferopsida.fasta

Fln subject: B8LKX7

Fln msg: Unexpected stop codon in the beginning of your sequence, Unexpected STOP codon at 3' end. Distance to subject end: 169 aas, your sequence is shorter than subject: 108 - 407

Fln protein: LKP*QDLKYFAIGSL*HIGMMPVNSLGGYLYYLTFTDDYSRKTWIYFLKKKDEVFSWFRHFKALIENQTEKKIKILRTDNGTEYESNEFHDFCKDAGIKRETTTPPS*

Protein Length: 109

Fln nts: CTCAAGCCATAGCAAGACCTCAAGTATTTTGCAATTGGTTCACTTTGACATATTGGTATGATGCCTGTGAACTCTTTGGGAGGATATTTATATTATCTCACTTTTACAGATGATTATTCTCGCAAGACTTGGATATACTTCTTGAAAAAGAAGGATGAAGTGTTCTCTTGGTTCCGTCACTTCAAAGCCTTGATCGAGAATCAAACCGAGAAGAAGATCAAGATCTTAAGGACTGATAATGGGACTGAGTATGAATCCAATGAGTTCCATGACTTTTGCAAAGATGCTGGCATTAAGAGGGAGACCACAACACCTCCATCCTGAGCAGAATGGTTTACATT

Fln Alignment:

AllPine_a_c12191___IGMMPVNSLGGYLYYLTFTDDYSRKTWIYFLKKKDEVFSWFRHFKALIENQTEKKIKILRTDNGTEYESNEFHDFCKDAGIKRETTTP
B8LKX7_______________MGPLEHPSISGSRYVLTFIDDYSRRIWVYFLKNKDEVFEKFKEFKAFVEKQSGKSIKILRTDNGKEYVNKEFDHYCKYNGIKREHTVP

SNPs (tot: 39)

Position	A %	C %	G %	T %	Probability
67		80		20	0.995493
68		40		60	1.0
69	20		80		0.995493
77		50		50	1.0
98		20	20	60	0.99255
104	20			80	0.995493
110	80			20	0.995493
111	20		80		0.995493
116		40		60	1.0
123	20	80			0.995493
124	20		80		0.995493
125		80	20		0.995493
131			20	80	0.995493
135	80	20			0.995493
151	66		16	16	0.98884
170		33		66	1.0
171	16			83	0.994512
176		66		33	1.0
177		83		16	0.994512
178	16		83		0.994512
179	16			83	0.994512
192		16		83	0.994512
194			83	16	0.994512
209		80		20	0.995493
212	20		80		0.995493
213	80			20	0.995493
217	50		50		1.0
224	20		80		0.995493
225	80			20	0.995493
229	20			80	0.995493
230	80	20			0.995493
231	80	20			0.995493
232			80	20	0.995493
233			80	20	0.995493
237	25		75		0.996473
250	33	33			0.997753
253	25		50	25	0.995533
289	33		33	33	0.997752
291		66		33	0.997452

Back

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain