UniGene Name: sp_v3.0_unigene81741
Length: 143 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
UniGene Fasta (sense) |
---|
>sp_v3.0_unigene81741
C |
Ace file of the UniGene sp_v3.0_unigene81741 (antisense) |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | p-type ATPase superfamily n=1 Tax=Micromonas pusilla CCMP1545 RepID=C1N491_MICPC | - | - | 4.0e-08 | 84% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 84% |
Sma3 | Endoplasmic reticulum [ER]-type calcium ATPase | - | - | 5.091e-10 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Calcium-transporting ATPase. | EC:3.6.3.8 | - | 4.196e-15 | - |
Source | Gene names |
---|---|
Sma3 | ACA3; ACA5; A_TM018A10.4; At1g07670; At1g07810; At4g00900; CA6; CA7; CHLREDRAFT_77047; ECA1; ECA2; ECA4; F24B9.9; GSVIVT00023099001; GSVIVT00024422001; LCA1; LOC_Os03g17310; MICPUCDRAFT_36018; MICPUN_97933; OSTLU_29095; Os03g0281600; Os05g0120700; OsI_110 |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
Sma3 | integral to endoplasmic reticulum membrane | GO:0030176 | Cellular Component | 0.0 | - |
Sma3 | magnesium ion binding | GO:0000287 | Molecular Function | 0.0 | - |
Sma3 | calcium-transporting ATPase activity | GO:0005388 | Molecular Function | 0.0 | - |
Sma3 | calcium ion binding | GO:0005509 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | ATPase activity, coupled to transmembrane movement of ions, phosphorylative mechanism | GO:0015662 | Molecular Function | 0.0 | - |
Sma3 | ATP biosynthetic process | GO:0006754 | Biological Process | 0.0 | - |
Sma3 | cation transport | GO:0006812 | Biological Process | 0.0 | - |
Sma3 | calcium ion transport | GO:0006816 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | ATPase, F1/V1/A1 complex, alpha/beta subunit, nucleotide-binding domain | IPR000194 | - | 0.0 | - |
Sma3 | ATPase, P-type, H+ transporting proton pump | IPR000695 | - | 0.0 | - |
Sma3 | ATPase, P-type, K/Mg/Cd/Cu/Zn/Na/Ca/Na/H-transporter | IPR001757 | - | 0.0 | - |
Sma3 | ATPase, P-type cation-transporter, N-terminal | IPR004014 | - | 0.0 | - |
Sma3 | ATPase, P-type, calcium-transporting | IPR005782 | - | 0.0 | - |
Sma3 | Haloacid dehalogenase-like hydrolase | IPR005834 | - | 0.0 | - |
Sma3 | ATPase, P-type cation-transporter, C-terminal | IPR006068 | - | 0.0 | - |
Sma3 | ATPase, P-type cation exchange, alpha subunit | IPR006069 | - | 0.0 | - |
Sma3 | ATPase, P-type, ATPase-associated domain | IPR008250 | - | 0.0 | - |
Sma3 | ATPase, P-type phosphorylation site | IPR018303 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT1G07810.1 | ECA1, ATECA1, ACA3 ER-type Ca2+-ATPase 1 chr1:2416681-2420572 FORWARD LENGTH=1061 | 2.0e-11 | 78% |
RefSeq | Arabidopsis thaliana | NP_172259.1 | Ca2+-transporting ATPase [Arabidopsis thaliana] | 2.0e-11 | 78% |
RefSeq | Populus trichocarpa | XP_002330877.1 | endoplasmic reticulum [ER]-type calcium ATPase, partial [Populus trichocarpa] | 2.0e-11 | 78% |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: D5AEI1
Fln msg: Unexpected STOP codon at 3' end. Distance to subject end: 204 aas, your sequence is shorter than subject: 41 - 340
Fln protein:
L
Protein Length:
42
Fln nts:
C
Fln Alignment:
GD4IA4403FUZWE___LTAALGMPEGLIPVQLLWVNLVTDGPPSNSSRF
D5AEI1_______________LTAALGMPEGLIPVQLLWVNLVTDGPPATALGF
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain