UniGene Name: sp_v3.0_unigene81680
Length: 224 nt
UniGene Fasta |
---|
>sp_v3.0_unigene81680
T |
Ace file of the UniGene sp_v3.0_unigene81680 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Unassigned protein | - | - | 0.0 | - |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 67% |
Sma3 | Pentatricopeptide repeat-containing protein, putative | - | - | 1.868e-10 | - |
Source | Gene names |
---|---|
Sma3 | At1g06140; At1g20230; At3g49170; EMB2261; F2K15.30; GSVIVT00000117001; GSVIVT00000282001; GSVIVT00006499001; GSVIVT00006886001; GSVIVT00013497001; GSVIVT00015527001; GSVIVT00015978001; GSVIVT00016595001; GSVIVT00017247001; GSVIVT00017291001; GSVIVT0001743 |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | intracellular | GO:0005622 | Cellular Component | 0.0 | - |
Sma3 | mitochondrion | GO:0005739 | Cellular Component | 0.0 | - |
Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
Sma3 | ubiquitin thiolesterase activity | GO:0004221 | Molecular Function | 0.0 | - |
Sma3 | binding | GO:0005488 | Molecular Function | 0.0 | - |
Sma3 | deaminase activity | GO:0019239 | Molecular Function | 0.0 | - |
Sma3 | ubiquitin-dependent protein catabolic process | GO:0006511 | Biological Process | 0.0 | - |
Sma3 | purine ribonucleoside monophosphate biosynthetic process | GO:0009168 | Biological Process | 0.0 | - |
Sma3 | embryo development ending in seed dormancy | GO:0009793 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Peptidase S8/S53, subtilisin/kexin/sedolisin | IPR000209 | - | 0.0 | - |
Sma3 | Beta-lactamase, class-A/D | IPR000871 | - | 0.0 | - |
Sma3 | Adenosine/AMP deaminase domain | IPR001365 | - | 0.0 | - |
Sma3 | Peptidase C12, ubiquitin carboxyl-terminal hydrolase 1 | IPR001578 | - | 0.0 | - |
Sma3 | Pentatricopeptide repeat | IPR002885 | - | 0.0 | - |
Sma3 | Domain of unknown function DUF659 | IPR007021 | - | 0.0 | - |
Sma3 | IPR011523 | - | 0.0 | - | |
Sma3 | Tetratricopeptide-like helical | IPR011990 | - | 0.0 | - |
Sma3 | EGF-like region, conserved site | IPR013032 | - | 0.0 | - |
Sma3 | Asp/Glu racemase, active site | IPR018187 | - | 0.0 | - |
Sma3 | WD40 repeat, conserved site | IPR019775 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT1G06140.1 | Pentatricopeptide repeat (PPR) superfamily protein chr1:1864796-1866472 FORWARD LENGTH=558 | 4.0e-18 | 69% |
RefSeq | Arabidopsis thaliana | NP_172104.1 | pentatricopeptide repeat-containing protein [Arabidopsis thaliana] | 5.0e-18 | 69% |
RefSeq | Populus trichocarpa | XP_002300144.1 | predicted protein [Populus trichocarpa] | 2.0e-17 | 60% |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: D5ADG9
Fln msg: Unexpected stop codon in the beginning of your sequence, Distance to subject end: 216 aas, your sequence is shorter than subject: 74 - 312
Fln protein:
A
Protein Length:
75
Fln nts:
T
Fln Alignment:
GFIJCBT03GIO56___LPLISLLSACSHAGLVEEGWLYFKSMSEDYDITPEVEHYACIVDLLGRAGRI
D5ADG9_______________ITFISVLSACSHAGLVDEGWKCYNCMTLDYAITPTVEHYACMVDLLGRAGHL
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain