UniGene Name: sp_v3.0_unigene81647
Length: 131 nt
![]() |
---|
>sp_v3.0_unigene81647
G |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Kinase, putative n=1 Tax=Ricinus communis RepID=B9SF98_RICCO | - | - | 9.0e-10 | 73% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 80% |
Source | Gene names |
---|---|
Sma3 | At4g38830; At5g40380; BRLK; CRK26; CRK42; GSVIVT00002759001; GSVIVT00010175001; GSVIVT00013440001; GSVIVT00020696001; GSVIVT00027503001; GSVIVT00033130001; MPO12.90; Os08g0179000; POPTRDRAFT_232142; POPTRDRAFT_268982; POPTRDRAFT_291016; POPTRDRAFT_422898; |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
Sma3 | protein serine/threonine kinase activity | GO:0004674 | Molecular Function | 0.0 | - |
Sma3 | receptor activity | GO:0004872 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | sugar binding | GO:0005529 | Molecular Function | 0.0 | - |
Sma3 | protein phosphorylation | GO:0006468 | Biological Process | 0.0 | - |
Sma3 | recognition of pollen | GO:0048544 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Toll/interleukin-1 receptor homology (TIR) domain | IPR000157 | - | 0.0 | - |
Sma3 | Protein kinase, catalytic domain | IPR000719 | - | 0.0 | - |
Sma3 | Epidermal growth factor-like domain | IPR000742 | - | 0.0 | - |
Sma3 | S-locus glycoprotein | IPR000858 | - | 0.0 | - |
Sma3 | Bulb-type lectin domain | IPR001480 | - | 0.0 | - |
Sma3 | Cadherin | IPR002126 | - | 0.0 | - |
Sma3 | Gnk2-homologous domain | IPR002902 | - | 0.0 | - |
Sma3 | Apple-like | IPR003609 | - | 0.0 | - |
Sma3 | Phosphopantetheine attachment site | IPR006162 | - | 0.0 | - |
Sma3 | Epidermal growth factor-like | IPR006210 | - | 0.0 | - |
Sma3 | Serine/threonine-protein kinase, active site | IPR008271 | - | 0.0 | - |
Sma3 | PAN-2 domain | IPR013227 | - | 0.0 | - |
Sma3 | Protein kinase, ATP binding site | IPR017441 | - | 0.0 | - |
Sma3 | IPR017442 | - | 0.0 | - | |
Sma3 | Ribosomal protein S6e, conserved site | IPR018282 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT5G40380.1 | CRK42 cysteine-rich RLK (RECEPTOR-like protein kinase) 42 chr5:16152121-16155038 FORWARD LENGTH=651 | 4.0e-14 | 71% |
RefSeq | Arabidopsis thaliana | NP_198854.3 | cysteine-rich receptor-like protein kinase 42 [Arabidopsis thaliana] | 6.0e-14 | 71% |
RefSeq | Populus trichocarpa | XP_002336757.1 | predicted protein, partial [Populus trichocarpa] | 2.0e-14 | 71% |
![]() |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: B8LLJ5
Fln msg: Unexpected STOP codon at 3' end. Distance to subject end: 81 aas, your sequence is shorter than subject: 43 - 505
Fln protein:
E
Protein Length:
44
Fln nts:
G
Fln Alignment:
GDTE5QK01EH5AA___EANLINCIQHRNLVKLLGCSFESSERLLVYEYLPNSSLDRFI
B8LLJ5_______________EANLISRVQHRNLVKLLGCSVENSERLLVYEYLQNSSLDKII
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain