UniGene Name: sp_v3.0_unigene81625
Length: 125 nt
UniGene Fasta |
---|
>sp_v3.0_unigene81625
T |
Ace file of the UniGene sp_v3.0_unigene81625 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | alpha-1,3-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase [Arabidopsis thaliana] ref|NP_849517.1| alpha-1,3-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase [Arabidopsis thaliana] sp|Q9XGM8.1|MGAT1_ARATH RecName: Full=Alpha-1,3-ma | - | - | 7.0e-13 | 88% |
FL-Next | sp=Alpha-1,3-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase; Arabidopsis thaliana (Mouse-ear cress). | - | - | 0.0 | 88% |
Sma3 | N-acetylglucosaminyltransferase I | - | - | 7.024e-16 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Alpha-1,3-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase. | EC:2.4.1.101 | - | 1.393e-19 | - |
Source | KEGGs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | N-Glycan biosynthesis | 00510 | 1.393e-19 | % | |
Sma3 | Various types of N-glycan biosynthesis | 00513 | 1.393e-19 | % | |
Sma3 | Metabolic pathways | 01100 | 1.393e-19 | % |
Source | Gene names |
---|---|
Sma3 | At4g38240; CGL1; F20D10.360; F22I13.10; GNTI; GntI; MICPUN_68567; OJ1149_C12.27; OJ1282_E10.3; Os02g0832800; OsJ_09008; PHYPADRAFT_214349; PHYPADRAFT_93681; POPTRDRAFT_1085909; POPTRDRAFT_679961; RCOM_0600390; VITISV_026659; gnTI; mgat1; |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Golgi membrane | GO:0000139 | Cellular Component | 0.0 | - |
Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
Sma3 | alpha-1,3-mannosylglycoprotein 2-beta-N-acetylglucosaminyltransferase activity | GO:0003827 | Molecular Function | 0.0 | - |
Sma3 | transaminase activity | GO:0008483 | Molecular Function | 0.0 | - |
Sma3 | protein N-acetylglucosaminyltransferase activity | GO:0016262 | Molecular Function | 0.0 | - |
Sma3 | protein N-linked glycosylation | GO:0006487 | Biological Process | 0.0 | - |
Sma3 | N-glycan processing | GO:0006491 | Biological Process | 0.0 | - |
Sma3 | hyperosmotic response | GO:0006972 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Lipocalin | IPR002345 | - | 0.0 | - |
Sma3 | Glycosyl transferase, family 13 | IPR004139 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT4G38240.1 | CGL1, CGL, GNTI alpha-1,3-mannosyl-glycoprotein beta-1,2-N-acetylglucosaminyltransferase, putative chr4:17932006-17935209 REVERSE LENGTH=444 | 5.0e-18 | 88% |
RefSeq | Arabidopsis thaliana | NP_849517.1 | alpha-1,3-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase [Arabidopsis thaliana] | 7.0e-18 | 88% |
RefSeq | Populus trichocarpa | XP_002328134.1 | predicted protein, partial [Populus trichocarpa] | 6.0e-19 | 88% |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: sp_plants
Fln subject: Q9XGM8
Fln msg: Unexpected stop codon in the beginning of your sequence, Distance to subject end: 123 aas, your sequence is shorter than subject: 41 - 444
Fln protein:
*
Protein Length:
42
Fln nts:
T
Fln Alignment:
GDTE5QK01B41BY___YWDDWIRLKEVRKDRQFIRPEVCRTYNFGEHGSSLG
Q9XGM8_______________YWDDWLRLKENHKGRQFIRPEVCRTYNFGEHGSSLG
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain