UniGene Name: sp_v3.0_unigene81618
Length: 138 nt
UniGene Fasta |
---|
>sp_v3.0_unigene81618
G |
Ace file of the UniGene sp_v3.0_unigene81618 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | ATP binding protein, putative n=1 Tax=Ricinus communis RepID=B9S8F8_RICCO | - | - | 4.0e-10 | 65% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 74% |
Sma3 | Serine/threonine-protein kinase NAK | - | - | 1.528e-06 | - |
Source | Gene names |
---|---|
Sma3 | APK1A; At1g07570; At2g48010; At3g58690/T20N10_40; F22G5.5; GSVIVT00006101001; GSVIVT00015440001; GSVIVT00018755001; GSVIVT00023633001; GSVIVT00035806001; GSVIVT00035810001; H0718E12.2; LOC_Os03g60710; MpRLK25; OJ1150_E04.115; OJ1200_C08.119; OJ1430_B02.5; |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
Sma3 | sequence-specific DNA binding transcription factor activity | GO:0003700 | Molecular Function | 0.0 | - |
Sma3 | protein kinase activity | GO:0004672 | Molecular Function | 0.0 | - |
Sma3 | protein serine/threonine kinase activity | GO:0004674 | Molecular Function | 0.0 | - |
Sma3 | protein tyrosine kinase activity | GO:0004713 | Molecular Function | 0.0 | - |
Sma3 | receptor activity | GO:0004872 | Molecular Function | 0.0 | - |
Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | sequence-specific DNA binding | GO:0043565 | Molecular Function | 0.0 | - |
Sma3 | regulation of transcription, DNA-dependent | GO:0006355 | Biological Process | 0.0 | - |
Sma3 | protein phosphorylation | GO:0006468 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Protein kinase, catalytic domain | IPR000719 | - | 0.0 | - |
Sma3 | Leucine-rich repeat | IPR001611 | - | 0.0 | - |
Sma3 | Transcription factor, MADS-box | IPR002100 | - | 0.0 | - |
Sma3 | Serine/threonine-protein kinase, active site | IPR008271 | - | 0.0 | - |
Sma3 | Protein kinase, ATP binding site | IPR017441 | - | 0.0 | - |
Sma3 | IPR017442 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT2G48010.1 | RKF3 receptor-like kinase in in flowers 3 chr2:19641465-19643318 FORWARD LENGTH=617 | 2.0e-14 | 69% |
RefSeq | Arabidopsis thaliana | NP_182322.1 | putative LRR receptor-like serine/threonine-protein kinase RKF3 [Arabidopsis thaliana] | 3.0e-14 | 69% |
RefSeq | Populus trichocarpa | XP_002332242.1 | predicted protein, partial [Populus trichocarpa] | 7.0e-16 | 65% |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: B8LPC1
Fln msg: Distance to subject end: 128 aas, your sequence is shorter than subject: 45 - 611
Fln protein:
Q
Protein Length:
46
Fln nts:
G
Fln Alignment:
GDTE5QK01C83R4___EEKSHYSTRTVGTLGYVASEYALYGHLTNKSDVFSFGIILLEL
B8LPC1_______________EGVSHLSTRVAGTLGYVAPEYALYGQLTEKSDVYSFGVVLLEL
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain