UniGene Name: sp_v3.0_unigene81614
Length: 234 nt
![]() |
---|
>sp_v3.0_unigene81614
A |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | alanyl-tRNA synthetase [Saccharomyces cerevisiae YJM789] | - | - | 8.0e-33 | 81% |
FL-Next | Isoform Cytoplasmic of Alanine--tRNA ligase OS=Arabidopsis thaliana GN=ALATS | - | - | 0.0 | 78% |
Sma3 | Alanyl-tRNA synthetase | - | - | 9.882e-11 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Alanine--tRNA ligase. | EC:6.1.1.7 | - | 7.061e-12 | - |
Source | KEGGs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Aminoacyl-tRNA biosynthesis | 00970 | 7.061e-12 | % |
Source | Gene names |
---|---|
Sma3 | ALARS; ALATS; ALATS1; ALATS2; At1g50200; CHLREDRAFT_38643; F14I3.17; GSVIVT00013953001; GSVIVT00030223001; GSVIVT00036226001; LOC_Os10g10244; MICPUCDRAFT_45734; MICPUN_62346; MICPUN_79369; OSJNBb0022I16.5; OSTLU_37270; Os06g0245800; Os10g0182000; OsI_2235 |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | cytoplasm | GO:0005737 | Cellular Component | 0.0 | - |
Sma3 | mitochondrion | GO:0005739 | Cellular Component | 0.0 | - |
Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
Sma3 | chloroplast stroma | GO:0009570 | Cellular Component | 0.0 | - |
Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
Sma3 | nucleic acid binding | GO:0003676 | Molecular Function | 0.0 | - |
Sma3 | alanine-tRNA ligase activity | GO:0004813 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | alanyl-tRNA aminoacylation | GO:0006419 | Biological Process | 0.0 | - |
Sma3 | embryo development ending in seed dormancy | GO:0009793 | Biological Process | 0.0 | - |
Sma3 | response to cadmium ion | GO:0046686 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Homeobox protein, antennapedia type, conserved site | IPR001827 | - | 0.0 | - |
Sma3 | Alanyl-tRNA synthetase, class IIc | IPR002318 | - | 0.0 | - |
Sma3 | Phosphoesterase, DHHA1 | IPR003156 | - | 0.0 | - |
Sma3 | Ubiquitin interacting motif | IPR003903 | - | 0.0 | - |
Sma3 | Glutathione S-transferase, N-terminal | IPR004045 | - | 0.0 | - |
Sma3 | Glutathione S-transferase, C-terminal | IPR004046 | - | 0.0 | - |
Sma3 | Protein of unknown function DUF544 | IPR007518 | - | 0.0 | - |
Sma3 | Glutathione S-transferase, C-terminal-like | IPR010987 | - | 0.0 | - |
Sma3 | Threonyl/alanyl tRNA synthetase, SAD | IPR012947 | - | 0.0 | - |
Sma3 | Glutathione S-transferase/chloride channel, C-terminal | IPR017933 | - | 0.0 | - |
Sma3 | HTH domain AraC-type, conserved site | IPR018062 | - | 0.0 | - |
Sma3 | Alanyl-tRNA synthetase, class IIc, N-terminal | IPR018164 | - | 0.0 | - |
Sma3 | Alanyl-tRNA synthetase, class IIc, core domain | IPR018165 | - | 0.0 | - |
Sma3 | EF-Hand 1, calcium-binding site | IPR018247 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT1G50200.1 | ALATS, ACD Alanyl-tRNA synthetase chr1:18591429-18598311 REVERSE LENGTH=1003 | 6.0e-40 | 78% |
RefSeq | Arabidopsis thaliana | NP_001185186.1 | Alanyl-tRNA synthetase [Arabidopsis thaliana] | 7.0e-40 | 78% |
RefSeq | Populus trichocarpa | XP_002307181.1 | predicted protein [Populus trichocarpa] | 9.0e-39 | 77% |
![]() |
---|
Fln status: Internal
Fln database: sp_plants
Fln subject: P36428-2
Fln msg: Distance to subject end: 798 aas, your sequence is shorter than subject: 77 - 955
Fln protein:
K
Protein Length:
78
Fln nts:
A
Fln Alignment:
GDTE5QK01C7KXO___KCIRAGGKHNDLEDVGKDSYHHTFFEMLGNWSFGDYFKKEAIEFSWEVLTKVYGLPKDRLYVTYYAGDPQNGIPTD
P36428-2_____________KCIRAGGKHNDLDDVGKDTYHHTFFEMLGNWSFGDYFKKEAIEWAWELLTKVYGLPTDRIYATYFGGDEKAGLQPD
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain