UniGene Name: sp_v3.0_unigene81528
Length: 225 nt
UniGene Fasta
|
|---|
| >sp_v3.0_unigene81528
T |
Ace file of the UniGene sp_v3.0_unigene81528
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | TPA: class III peroxidase 70 precursor [Oryza sativa Japonica Group] | - | - | 2.0e-13 | 60% |
| FL-Next | tr=Properoxidase; Picea abies (Norway spruce) (Picea excelsa). | - | - | 0.0 | 57% |
| Sma3 | Putative peroxidase | - | - | 1.896e-30 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Peroxidase. | EC:1.11.1.7 | - | 4.86251e-42 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Phenylalanine metabolism | 00360 | 4.86251e-42 | % | |
| Sma3 | Methane metabolism | 00680 | 4.86251e-42 | % | |
| Sma3 | Phenylpropanoid biosynthesis | 00940 | 4.86251e-42 | % | |
| Sma3 | Biosynthesis of phenylpropanoids | 01061 | 4.86251e-42 | % | |
| Sma3 | Metabolic pathways | 01100 | 4.86251e-42 | % | |
| Sma3 | Biosynthesis of secondary metabolites | 01110 | 4.86251e-42 | % |
| Source | Gene names |
|---|---|
| Sma3 | AP22.54; At1g05260; At2g18150; At4g11290; At4g33420; At4g36430; At5g17820; B1135C02.43; B1135C02.47; C7A10.930; DIDI 6G-3B; F8D23.7; F8L21.80; FP2; GSVIVT00006924001; GSVIVT00022533001; GSVIVT00022535001; GSVIVT00022537001; GSVIVT00026052001; GSVIVT000260 |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | extracellular region | GO:0005576 | Cellular Component | 0.0 | - |
| Sma3 | cell wall | GO:0005618 | Cellular Component | 0.0 | - |
| Sma3 | vacuole | GO:0005773 | Cellular Component | 0.0 | - |
| Sma3 | plant-type cell wall | GO:0009505 | Cellular Component | 0.0 | - |
| Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
| Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
| Sma3 | peroxidase activity | GO:0004601 | Molecular Function | 0.0 | - |
| Sma3 | iron ion binding | GO:0005506 | Molecular Function | 0.0 | - |
| Sma3 | calcium ion binding | GO:0005509 | Molecular Function | 0.0 | - |
| Sma3 | electron carrier activity | GO:0009055 | Molecular Function | 0.0 | - |
| Sma3 | heme binding | GO:0020037 | Molecular Function | 0.0 | - |
| Sma3 | response to oxidative stress | GO:0006979 | Biological Process | 0.0 | - |
| Sma3 | response to desiccation | GO:0009269 | Biological Process | 0.0 | - |
| Sma3 | response to cold | GO:0009409 | Biological Process | 0.0 | - |
| Sma3 | hyperosmotic salinity response | GO:0042538 | Biological Process | 0.0 | - |
| Sma3 | hydrogen peroxide catabolic process | GO:0042744 | Biological Process | 0.0 | - |
| Sma3 | oxidation-reduction process | GO:0055114 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Plant peroxidase | IPR000823 | - | 0.0 | - |
| Sma3 | Haem peroxidase, plant/fungal/bacterial | IPR002016 | - | 0.0 | - |
| Sma3 | Peroxidases heam-ligand binding site | IPR019793 | - | 0.0 | - |
| Sma3 | Peroxidase, active site | IPR019794 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT4G11290.1 | Peroxidase superfamily protein chr4:6869993-6871476 FORWARD LENGTH=326 | 3.0e-15 | 55% |
| RefSeq | Arabidopsis thaliana | NP_192868.1 | peroxidase 39 [Arabidopsis thaliana] | 3.0e-15 | 55% |
| RefSeq | Populus trichocarpa | XP_002338764.1 | predicted protein, partial [Populus trichocarpa] | 4.0e-15 | 50% |
Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: Q0JW36
Fln msg: Distance to subject end: 245 aas, your sequence is shorter than subject: 74 - 341
Fln protein:
N
Protein Length:
75
Fln nts:
T
Fln Alignment:
GDTE5QK01CK4P3___ISPVIVASANGLKVGYYRQSCPEXXXXXXXXXXXXXXXNPGIAASLIRMHFHDCFVRGCDGSILIDST
Q0JW36_______________IQTVDAQSCNGLSHHFYYKSCPKAQAIIKSVVEDAVRKEAGMAASLLRLHFHDCFVKGCDGSILLDDT

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
UniGene Fasta