UniGene Name: sp_v3.0_unigene81525
Length: 248 nt
UniGene Fasta
|
|---|
| >sp_v3.0_unigene81525
G |
Ace file of the UniGene sp_v3.0_unigene81525
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Glucosyltransferase n=1 Tax=Glycine max RepID=Q2VA65_SOYBN | - | - | 8.0e-17 | 64% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 94% |
| Sma3 | UDP-glucosyltransferase, putative | - | - | 2.321e-35 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Transferases, Glycosyltransferases, Hexosyltransferases. | EC:2.4.1.- | - | 3.415e-10 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Anthocyanin biosynthesis | 00942 | 2.01e-39 | % | |
| Sma3 | Metabolic pathways | 01100 | 2.01e-39 | % | |
| Sma3 | Biosynthesis of secondary metabolites | 01110 | 2.01e-39 | % |
| Source | Gene names |
|---|---|
| Sma3 | AdGt-13; AdGt-14; AdGt-9; AmUGT21; AmUGT36; At1g22340; At1g22400; At2g15480; At2g15490; At2g29740; At2g36760; At2g36770; At2g36780; At2g36790; At2g36800; At3g53150; At3g53160; At4g34138; CaUGT2; DOGT1; DcS10B5; DcS12A2; DcS6B11; DcT128; DicGT4; Eg7GT-A; E |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
| Sma3 | nucleic acid binding | GO:0003676 | Molecular Function | 0.0 | - |
| Sma3 | zinc ion binding | GO:0008270 | Molecular Function | 0.0 | - |
| Sma3 | transferase activity, transferring hexosyl groups | GO:0016758 | Molecular Function | 0.0 | - |
| Sma3 | anthocyanin 3'-O-beta-glucosyltransferase activity | GO:0033837 | Molecular Function | 0.0 | - |
| Sma3 | UDP-glucosyltransferase activity | GO:0035251 | Molecular Function | 0.0 | - |
| Sma3 | anthocyanidin 3-O-glucosyltransferase activity | GO:0047213 | Molecular Function | 0.0 | - |
| Sma3 | flavonol 3-O-glucosyltransferase activity | GO:0047893 | Molecular Function | 0.0 | - |
| Sma3 | trans-zeatin O-beta-D-glucosyltransferase activity | GO:0050403 | Molecular Function | 0.0 | - |
| Sma3 | cis-zeatin O-beta-D-glucosyltransferase activity | GO:0050502 | Molecular Function | 0.0 | - |
| Sma3 | transport | GO:0006810 | Biological Process | 0.0 | - |
| Sma3 | metabolic process | GO:0008152 | Biological Process | 0.0 | - |
| Sma3 | brassinosteroid metabolic process | GO:0016131 | Biological Process | 0.0 | - |
| Sma3 | flavonol biosynthetic process | GO:0051555 | Biological Process | 0.0 | - |
| Sma3 | response to other organism | GO:0051707 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Tobamoviral movement protein | IPR001022 | - | 0.0 | - |
| Sma3 | Transcription factor, fork head | IPR001766 | - | 0.0 | - |
| Sma3 | Zinc finger, CCHC-type | IPR001878 | - | 0.0 | - |
| Sma3 | UDP-glucuronosyl/UDP-glucosyltransferase | IPR002213 | - | 0.0 | - |
| Sma3 | IPR013084 | - | 0.0 | - | |
| Sma3 | Aldehyde dehydrogenase, conserved site | IPR016160 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT2G36790.1 | UGT73C6 UDP-glucosyl transferase 73C6 chr2:15420339-15421826 REVERSE LENGTH=495 | 2.0e-21 | 68% |
| RefSeq | Arabidopsis thaliana | NP_181217.1 | flavonol-3-O-glycoside-7-O-glucosyltransferase 1 [Arabidopsis thaliana] | 3.0e-21 | 68% |
| RefSeq | Populus trichocarpa | XP_002333410.1 | predicted protein [Populus trichocarpa] | 6.0e-21 | 75% |
Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: B8LPJ2
Fln msg: Overlapping hits, possible frame ERROR between 151 and 150, Distance to subject end: 56 aas, your sequence is shorter than subject: 83 - 498
Fln protein:
G
Protein Length:
84
Fln nts:
G
Fln Alignment:
GDTE5QK01A6JY7___GWAPQLLILSHPSIGAFLSHCGWNSVLESLSMGIPMITWPMFADQPYNSxLLEEHMGVAIRICEGMNSVPDEEDVGRAVIML
B8LPJ2_______________GWAPQLLILSHPSIGAFLSHCGWNSTLESVSMGIPMITWPMIADQPYNSxLLEERLGVAIRICAGVNSVPNEEEVRRAVTML

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
UniGene Fasta