SustainPineDB

All assemblies
Assembly info
Unigenes
SNPs
SSRs
Descriptions
GOs
ECs
KEGGs
InterPros
miRNAs

Assembly Name: SustainPine v3.0

UniGene Name: sp_v3.0_unigene81525

Length: 248 nt

UniGene Fasta

>sp_v3.0_unigene81525
GGGGTGGGCGCCTCAGCTCCTTATTCTCTCTCATCCTTCCATCGGTGCATTTCTCAGTCACTGCGGATGGAACTCTGTGCTGGAGAGCTTGAGCATGGGAATCCCCATGATCACCTGGCCCATGTTCGCAGATCAGCCATATAACTCAAAAGCTTCTGGAAGAACACATGGGCGTAGCCATACGGATATGTGAGGGAATGAACAGTGTGCCAGATGAAGAAGATGTGGGAAGGGCAGTTATCATGCTT

Ace file of the UniGene sp_v3.0_unigene81525

If you push the Download ace button, you will download an ace file of this UniGene.

To watch this ACE file you will need an ACE viewer program as Tablet:

Go to the Tablet ACE viewer Web

Annotations

Source	Descriptions	Term	Type	e value	Identity
AutoFact	Glucosyltransferase n=1 Tax=Glycine max RepID=Q2VA65_SOYBN	-	-	8.0e-17	64%
FL-Next	tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis).	-	-	0.0	94%
Sma3	UDP-glucosyltransferase, putative	-	-	2.321e-35	-

Source	ECs	Term	Type	e value	Identity
Sma3	Transferases, Glycosyltransferases, Hexosyltransferases.	EC:2.4.1.-	-	3.415e-10	-

Source	KEGGs	Term	Type	e value	Identity
Sma3	Fructose and mannose metabolism	00051		3.415e-10	%
Sma3	N-Glycan biosynthesis	00510		3.415e-10	%
Sma3	Mucin type O-Glycan biosynthesis	00512		3.415e-10	%
Sma3	Various types of N-glycan biosynthesis	00513		3.415e-10	%
Sma3	Other types of O-glycan biosynthesis	00514		3.415e-10	%
Sma3	Biosynthesis of 12-, 14- and 16-membered macrolides	00522		3.415e-10	%
Sma3	Glycosaminoglycan biosynthesis - keratan sulfate	00533		3.415e-10	%
Sma3	Lipopolysaccharide biosynthesis	00540		3.415e-10	%
Sma3	Peptidoglycan biosynthesis	00550		3.415e-10	%
Sma3	Glycerolipid metabolism	00561		3.415e-10	%
Sma3	Glycosylphosphatidylinositol(GPI)-anchor biosynthesis	00563		3.415e-10	%
Sma3	Sphingolipid metabolism	00600		3.415e-10	%
Sma3	Glycosphingolipid biosynthesis - lacto and neolacto series	00601		3.415e-10	%
Sma3	Glycosphingolipid biosynthesis - globo series	00603		3.415e-10	%
Sma3	Glycosphingolipid biosynthesis - ganglio series	00604		3.415e-10	%
Sma3	Carotenoid biosynthesis	00906		3.415e-10	%
Sma3	Zeatin biosynthesis	00908		3.415e-10	%
Sma3	Flavonoid biosynthesis	00941		3.415e-10	%
Sma3	Anthocyanin biosynthesis	00942		3.415e-10	%
Sma3	Flavone and flavonol biosynthesis	00944		3.415e-10	%
Sma3	Stilbenoid, diarylheptanoid and gingerol biosynthesis	00945		3.415e-10	%
Sma3	Betalain biosynthesis	00965		3.415e-10	%
Sma3	Biosynthesis of type II polyketide products	01057		3.415e-10	%
Sma3	Metabolic pathways	01100		3.415e-10	%
Sma3	Biosynthesis of secondary metabolites	01110		3.415e-10	%
Sma3	Anthocyanidin 3-O-glucosyltransferase.	EC:2.4.1.115	-	2.01e-39	-

Source	KEGGs	Term	e value	Identity
Sma3	Anthocyanin biosynthesis	00942	2.01e-39	%
Sma3	Metabolic pathways	01100	2.01e-39	%
Sma3	Biosynthesis of secondary metabolites	01110	2.01e-39	%

Source	Gene names
Sma3	AdGt-13; AdGt-14; AdGt-9; AmUGT21; AmUGT36; At1g22340; At1g22400; At2g15480; At2g15490; At2g29740; At2g36760; At2g36770; At2g36780; At2g36790; At2g36800; At3g53150; At3g53160; At4g34138; CaUGT2; DOGT1; DcS10B5; DcS12A2; DcS6B11; DcT128; DicGT4; Eg7GT-A; E

Source	GOs	Term	Type	Identity
Sma3	integral to membrane	GO:0016021	Cellular Component	-
Sma3	nucleic acid binding	GO:0003676	Molecular Function	-
Sma3	zinc ion binding	GO:0008270	Molecular Function	-
Sma3	transferase activity, transferring hexosyl groups	GO:0016758	Molecular Function	-
Sma3	anthocyanin 3'-O-beta-glucosyltransferase activity	GO:0033837	Molecular Function	-
Sma3	UDP-glucosyltransferase activity	GO:0035251	Molecular Function	-
Sma3	anthocyanidin 3-O-glucosyltransferase activity	GO:0047213	Molecular Function	-
Sma3	flavonol 3-O-glucosyltransferase activity	GO:0047893	Molecular Function	-
Sma3	trans-zeatin O-beta-D-glucosyltransferase activity	GO:0050403	Molecular Function	-
Sma3	cis-zeatin O-beta-D-glucosyltransferase activity	GO:0050502	Molecular Function	-
Sma3	transport	GO:0006810	Biological Process	-
Sma3	metabolic process	GO:0008152	Biological Process	-
Sma3	brassinosteroid metabolic process	GO:0016131	Biological Process	-
Sma3	flavonol biosynthetic process	GO:0051555	Biological Process	-
Sma3	response to other organism	GO:0051707	Biological Process	-

Source	InterPros	Term	Type	Identity
Sma3	Tobamoviral movement protein	IPR001022	-	-
Sma3	Transcription factor, fork head	IPR001766	-	-
Sma3	Zinc finger, CCHC-type	IPR001878	-	-
Sma3	UDP-glucuronosyl/UDP-glucosyltransferase	IPR002213	-	-
Sma3		IPR013084	-	-
Sma3	Aldehyde dehydrogenase, conserved site	IPR016160	-	-

Source	Species	ID	Description	e value	Identity
ATG	Arabidoptis thaliana	AT2G36790.1	UGT73C6 UDP-glucosyl transferase 73C6 chr2:15420339-15421826 REVERSE LENGTH=495	2.0e-21	68%
RefSeq	Arabidopsis thaliana	NP_181217.1	flavonol-3-O-glycoside-7-O-glucosyltransferase 1 [Arabidopsis thaliana]	3.0e-21	68%
RefSeq	Populus trichocarpa	XP_002333410.1	predicted protein [Populus trichocarpa]	6.0e-21	75%

Full-Lengther Next Prediction

Fln status: Internal

Fln database: coniferopsida.fasta

Fln subject: B8LPJ2

Fln msg: Overlapping hits, possible frame ERROR between 151 and 150, Distance to subject end: 56 aas, your sequence is shorter than subject: 83 - 498

Fln protein: GWAPQLLILSHPSIGAFLSHCGWNSVLESLSMGIPMITWPMFADQPYNSxxLLEEHMGVAIRICEGMNSVPDEEDVGRAVIML

Protein Length: 84

Fln nts: GGGGTGGGCGCCTCAGCTCCTTATTCTCTCTCATCCTTCCATCGGTGCATTTCTCAGTCACTGCGGATGGAACTCTGTGCTGGAGAGCTTGAGCATGGGAATCCCCATGATCACCTGGCCCATGTTCGCAGATCAGCCATATAACTCAxxxxxxCTTCTGGAAGAACACATGGGCGTAGCCATACGGATATGTGAGGGAATGAACAGTGTGCCAGATGAAGAAGATGTGGGAAGGGCAGTTATCATGCTT

Fln Alignment:

GDTE5QK01A6JY7___GWAPQLLILSHPSIGAFLSHCGWNSVLESLSMGIPMITWPMFADQPYNSxLLEEHMGVAIRICEGMNSVPDEEDVGRAVIML
B8LPJ2_______________GWAPQLLILSHPSIGAFLSHCGWNSTLESVSMGIPMITWPMIADQPYNSxLLEERLGVAIRICAGVNSVPNEEEVRRAVTML

Back

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain