UniGene Name: sp_v3.0_unigene81455
Length: 216 nt
UniGene Fasta |
---|
>sp_v3.0_unigene81455
T |
Ace file of the UniGene sp_v3.0_unigene81455 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | putative protein phosphatase-2C (PP2C) [Arabidopsis thaliana] | - | - | 8.0e-17 | 72% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 77% |
Sma3 | Protein phosphatase-2c, putative | - | - | 1.702e-17 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Phosphoprotein phosphatase. | EC:3.1.3.16 | - | 2.8026e-44 | - |
Source | Gene names |
---|---|
Sma3 | AT3G05640; At1g03590; At1g16220; At1g79630; At3g02750; At3g05640; At3g16800; At4g03415; At5g26010; At5g27930; At5g36250; F13E7.31; F14I23.90; F15F15.3; F18C1.9; F20B17.6; F21B7.20; F3O9.3; GSVIVT00003341001; GSVIVT00022698001; GSVIVT00025063001; GSVIVT000 |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
Sma3 | cytoplasm | GO:0005737 | Cellular Component | 0.0 | - |
Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
Sma3 | magnesium ion binding | GO:0000287 | Molecular Function | 0.0 | - |
Sma3 | catalytic activity | GO:0003824 | Molecular Function | 0.0 | - |
Sma3 | phosphoprotein phosphatase activity | GO:0004721 | Molecular Function | 0.0 | - |
Sma3 | solute:hydrogen antiporter activity | GO:0015299 | Molecular Function | 0.0 | - |
Sma3 | manganese ion binding | GO:0030145 | Molecular Function | 0.0 | - |
Sma3 | cation transport | GO:0006812 | Biological Process | 0.0 | - |
Sma3 | response to water deprivation | GO:0009414 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | ATPase, F1/V1/A1 complex, alpha/beta subunit, nucleotide-binding domain | IPR000194 | - | 0.0 | - |
Sma3 | Protein phosphatase 2C, manganese/magnesium aspartate binding site | IPR000222 | - | 0.0 | - |
Sma3 | Protein phosphatase 2C-like | IPR001932 | - | 0.0 | - |
Sma3 | Cation/H+ exchanger | IPR006153 | - | 0.0 | - |
Sma3 | IPR014045 | - | 0.0 | - | |
Sma3 | Protein phosphatase 2C | IPR015655 | - | 0.0 | - |
Sma3 | Protein kinase, ATP binding site | IPR017441 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT3G02750.3 | Protein phosphatase 2C family protein chr3:593601-595457 REVERSE LENGTH=527 | 5.0e-22 | 72% |
RefSeq | Arabidopsis thaliana | NP_974180.1 | putative protein phosphatase 2C 18 [Arabidopsis thaliana] | 5.0e-22 | 72% |
RefSeq | Populus trichocarpa | XP_002330233.1 | predicted protein [Populus trichocarpa] | 5.0e-22 | 66% |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: C0PRD1
Fln msg: Distance to subject end: 151 aas, your sequence is shorter than subject: 72 - 523
Fln protein:
F
Protein Length:
73
Fln nts:
T
Fln Alignment:
GDTE5QK01CYLK0___FGDLCLKDFGVIAVPEVTCRRLTNRDQFIVLATDGVWDVLSNQEVVSIVSSAPS
C0PRD1_______________FGDFCLKDFGLIAVPDISYRRLTQRDEFIVLATDGVWDVLSNKEVVDIVASAPT
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain