UniGene Name: sp_v3.0_unigene81379
Length: 185 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
![]() |
---|
>sp_v3.0_unigene81379
C |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | ATP-binding cassette transporter, putative n=1 Tax=Ricinus communis RepID=B9RQF2_RICCO | - | - | 1.0e-16 | 70% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 53% |
Sma3 | ATP-binding cassette transporter, putative | - | - | 5.147e-14 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Phosphonate-transporting ATPase. | EC:3.6.3.28 | - | 1.719e-08 | - |
Sma3 | Heme-transporting ATPase. | EC:3.6.3.41 | - | 4.117e-07 | - |
Source | Gene names |
---|---|
Sma3 | At1g15210; At1g59870; F23H11.19; F9L1.15; GSVIVT00034307001; GSVIVT00034310001; GSVIVT00034318001; GSVIVT00034321001; LOC_Os01g52560; Os01g0724400; Os01g0724500; OsI_03578; OsJ_03311; PDR15; PDR7; PDR8; PHYPADRAFT_128826; PHYPADRAFT_226738; POPTRDRAFT_589 |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | mitochondrion | GO:0005739 | Cellular Component | 0.0 | - |
Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
Sma3 | chloroplast envelope | GO:0009941 | Cellular Component | 0.0 | - |
Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | cadmium ion transmembrane transporter activity | GO:0015086 | Molecular Function | 0.0 | - |
Sma3 | ATPase activity | GO:0016887 | Molecular Function | 0.0 | - |
Sma3 | transport | GO:0006810 | Biological Process | 0.0 | - |
Sma3 | systemic acquired resistance | GO:0009627 | Biological Process | 0.0 | - |
Sma3 | defense response to fungus, incompatible interaction | GO:0009817 | Biological Process | 0.0 | - |
Sma3 | cadmium ion transport | GO:0015691 | Biological Process | 0.0 | - |
Sma3 | negative regulation of defense response | GO:0031348 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | ABC transporter-like | IPR003439 | - | 0.0 | - |
Sma3 | AAA+ ATPase domain | IPR003593 | - | 0.0 | - |
Sma3 | Phosphopantetheine attachment site | IPR006162 | - | 0.0 | - |
Sma3 | ABC-2 type transporter | IPR013525 | - | 0.0 | - |
Sma3 | Plant PDR ABC transporter associated | IPR013581 | - | 0.0 | - |
Sma3 | ABC transporter, conserved site | IPR017871 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT1G15210.1 | PDR7, ATPDR7 pleiotropic drug resistance 7 chr1:5231552-5236573 REVERSE LENGTH=1442 | 9.0e-20 | 63% |
RefSeq | Arabidopsis thaliana | NP_172973.1 | ABC transporter G family member 35 [Arabidopsis thaliana] | 1.0e-19 | 63% |
RefSeq | Populus trichocarpa | XP_002303308.1 | predicted protein [Populus trichocarpa] | 2.0e-20 | 62% |
![]() |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: B8LN70
Fln msg: Distance to subject end: 258 aas, your sequence is shorter than subject: 61 - 443
Fln protein:
H
Protein Length:
62
Fln nts:
C
Fln Alignment:
GDTE5QK01ET8AR___LTVDAECYVGSRGLPTLWNTARNLVEYLIGMVGLSLTKKVNLTILKDASGILKPSRMTLL
B8LN70_______________LNISADVYVGSRALPTLINWTVNIVEDALETLRLRKTQKKNLTILHDISGIVKSGRLTLL
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain