|
||||||
|
UniGene Name: sp_v3.0_unigene81320
Length: 220 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene81320
G |
|
Ace file of the UniGene sp_v3.0_unigene81320
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Heat shock protein n=1 Tax=Glycine max RepID=Q39889_SOYBN | - | - | 1.0e-23 | 80% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 84% |
| Sma3 | Heat shock protein 101 | - | - | 4.587e-16 | - |
| Source | Gene names |
|---|---|
| Sma3 | AT4g14670; At1g74310; At2g25140; At3g48870; At5g15450; At5g50920; At5g51070; AtclpC; CD4A; CD4B; CHLREDRAFT_172454; CHLREDRAFT_195417; CHLREDRAFT_195422; CHLREDRAFT_195423; CLP2; CLPA; CLPB1; CLPB2; CLPB3; CLPC1; CLPC2; CLPD1; ClpC; ERD1; F1O17.2; GSVIVT0 |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | cell wall | GO:0005618 | Cellular Component | 0.0 | - |
| Sma3 | mitochondrion | GO:0005739 | Cellular Component | 0.0 | - |
| Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
| Sma3 | chloroplast thylakoid membrane | GO:0009535 | Cellular Component | 0.0 | - |
| Sma3 | chloroplast stroma | GO:0009570 | Cellular Component | 0.0 | - |
| Sma3 | chloroplast envelope | GO:0009941 | Cellular Component | 0.0 | - |
| Sma3 | Tic complex | GO:0031897 | Cellular Component | 0.0 | - |
| Sma3 | DNA binding | GO:0003677 | Molecular Function | 0.0 | - |
| Sma3 | ATP-dependent peptidase activity | GO:0004176 | Molecular Function | 0.0 | - |
| Sma3 | nuclease activity | GO:0004518 | Molecular Function | 0.0 | - |
| Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
| Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
| Sma3 | peptidase activity | GO:0008233 | Molecular Function | 0.0 | - |
| Sma3 | nucleoside-triphosphatase activity | GO:0017111 | Molecular Function | 0.0 | - |
| Sma3 | nucleotide-excision repair | GO:0006289 | Biological Process | 0.0 | - |
| Sma3 | response to stress | GO:0006950 | Biological Process | 0.0 | - |
| Sma3 | response to heat | GO:0009408 | Biological Process | 0.0 | - |
| Sma3 | response to high light intensity | GO:0009644 | Biological Process | 0.0 | - |
| Sma3 | chloroplast organization | GO:0009658 | Biological Process | 0.0 | - |
| Sma3 | regulation of chlorophyll biosynthetic process | GO:0010380 | Biological Process | 0.0 | - |
| Sma3 | protein metabolic process | GO:0019538 | Biological Process | 0.0 | - |
| Sma3 | response to hydrogen peroxide | GO:0042542 | Biological Process | 0.0 | - |
| Sma3 | protein unfolding | GO:0043335 | Biological Process | 0.0 | - |
| Sma3 | protein import into chloroplast stroma | GO:0045037 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | GPCR, rhodopsin-like, 7TM | IPR000276 | - | 0.0 | - |
| Sma3 | Chaperonin ClpA/B | IPR001270 | - | 0.0 | - |
| Sma3 | UVR domain | IPR001943 | - | 0.0 | - |
| Sma3 | AAA+ ATPase domain | IPR003593 | - | 0.0 | - |
| Sma3 | ATPase, AAA-type, core | IPR003959 | - | 0.0 | - |
| Sma3 | Clp, N-terminal | IPR004176 | - | 0.0 | - |
| Sma3 | ATPase, AAA-2 | IPR013093 | - | 0.0 | - |
| Sma3 | Chaperonin ClpB | IPR017730 | - | 0.0 | - |
| Sma3 | EF-Hand 1, calcium-binding site | IPR018247 | - | 0.0 | - |
| Sma3 | Chaperonin ClpA/B, conserved site | IPR018368 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT1G74310.1 | ATHSP101, HSP101, HOT1 heat shock protein 101 chr1:27936715-27939862 REVERSE LENGTH=911 | 4.0e-28 | 75% |
| RefSeq | Arabidopsis thaliana | NP_565083.1 | heat shock protein 101 [Arabidopsis thaliana] | 5.0e-28 | 75% |
| RefSeq | Populus trichocarpa | XP_002328643.1 | predicted protein [Populus trichocarpa] | 5.0e-28 | 77% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: A9NQA7
Fln msg: Distance to subject end: 179 aas, your sequence is shorter than subject: 72 - 278
Fln protein:
G
Protein Length:
73
Fln nts:
G
Fln Alignment:
GDTE5QK01D5Q13___GQLIEAVRRRPYSVVLFYEVEKAHTPVFNTLLQMLNDGRLMDGQGCTVSFSNRLISMTSNLGAEHLLVALSG
A9NQA7_______________GQLTEAVRRRPYSVVLFDEVEKAHTSVFNTLLQMLDDGRLTDGQGRTVSFSNTVIIMTSNLGAEHLLAALTG
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
