UniGene Name: sp_v3.0_unigene81298
Length: 217 nt
UniGene Fasta |
---|
>sp_v3.0_unigene81298
G |
Ace file of the UniGene sp_v3.0_unigene81298 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Quinone oxidoreductase, putative n=1 Tax=Ricinus communis RepID=B9TA76_RICCO | - | - | 1.0e-21 | 79% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 83% |
Sma3 | Chloroplastic quinone-oxidoreductase | - | - | 2.058e-12 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | NADPH:quinone reductase. | EC:1.6.5.5 | - | 7.937e-13 | - |
Source | Gene names |
---|---|
Sma3 | At4g13010; F25G13_100; GSVIVT00011021001; GSVIVT00011023001; GSVIVT00011024001; GSVIVT00011026001; LEDI-4; OSIGBa0104J13.1; OSIGBa0104J13.8; OSIGBa0105P02.6; OSIGBa0113I06.1; OSJNBa0018J19.11; OSJNBa0018J19.3; Os04g0358000; Os04g0359100; Os09g0502500; OsI |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | vacuole | GO:0005773 | Cellular Component | 0.0 | - |
Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
Sma3 | plastid inner membrane | GO:0009528 | Cellular Component | 0.0 | - |
Sma3 | chloroplast thylakoid membrane | GO:0009535 | Cellular Component | 0.0 | - |
Sma3 | zinc ion binding | GO:0008270 | Molecular Function | 0.0 | - |
Sma3 | oxidoreductase activity | GO:0016491 | Molecular Function | 0.0 | - |
Sma3 | metabolic process | GO:0008152 | Biological Process | 0.0 | - |
Sma3 | oxidation-reduction process | GO:0055114 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | ATPase, F1 complex, gamma subunit | IPR000131 | - | 0.0 | - |
Sma3 | Alcohol dehydrogenase superfamily, zinc-type | IPR002085 | - | 0.0 | - |
Sma3 | Quinone oxidoreductase/zeta-crystallin, conserved site | IPR002364 | - | 0.0 | - |
Sma3 | Endonuclease III-like, iron-sulphur cluster loop motif | IPR003651 | - | 0.0 | - |
Sma3 | Alcohol dehydrogenase, C-terminal | IPR013149 | - | 0.0 | - |
Sma3 | Alcohol dehydrogenase GroES-like | IPR013154 | - | 0.0 | - |
Sma3 | NAD(P)-binding domain | IPR016040 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT4G13010.1 | Oxidoreductase, zinc-binding dehydrogenase family protein chr4:7600682-7602567 FORWARD LENGTH=329 | 4.0e-22 | 75% |
RefSeq | Arabidopsis thaliana | NP_193037.1 | putative quinone-oxidoreductase-like protein [Arabidopsis thaliana] | 6.0e-22 | 75% |
RefSeq | Populus trichocarpa | XP_002336761.1 | predicted protein, partial [Populus trichocarpa] | 1.0e-23 | 79% |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: D5AD48
Fln msg: Overlapping hits, possible frame ERROR between 55 and 55, Distance to subject end: 78 aas, your sequence is shorter than subject: 72 - 333
Fln protein:
H
Protein Length:
73
Fln nts:
G
Fln Alignment:
GDTE5QK01BI0GH___HVTATCGARNMSMIKDLGADEVLDYKTPEGAALKSPSGRKYDAVINGAHDIPWSTFKPNLSPSAKVIDLTPN
D5AD48_______________HVTATCGARNVSLIKELGADEVLDYKTPEGAALKSPSGRKYDAVIHCTSNIPWSIFQPNLSPNGKVIDFTPN
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain