SustainPineDB

All assemblies
Assembly info
Unigenes
SNPs
SSRs
Descriptions
GOs
ECs
KEGGs
InterPros
miRNAs

Assembly Name: SustainPine v3.0

UniGene Name: sp_v3.0_unigene81287

Length: 252 nt

This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense

UniGene Fasta (sense)

>sp_v3.0_unigene81287
CCATGGTGGGCGACGGCGTGAATGACGCGCCCGCGCTGGCCGCGGCCGATGTGGGCATGGCCATGGGCAATGGTACCGACGTGGCCATGCACGCGGCGGGCATCACGCTGATGCGCGGCGACCCGCAATTGGTGGCGGCGGCGCTGGACATCTCGCGGCGCACGGTGGCCAAGATCCGCCAGAACCTGTTTTGGGCCTTTGCATACAACGTGGCCGGTATTCCGCTGGCGGCGCTGGGCTACCTGAGTCCCG

Ace file of the UniGene sp_v3.0_unigene81287 (antisense)

If you push the Download ace button, you will download an ace file of this UniGene.

To watch this ACE file you will need an ACE viewer program as Tablet:

Go to the Tablet ACE viewer Web

Annotations

Source	Descriptions	Term	Type	e value	Identity
AutoFact	Heavy metal translocating P-type ATPase n=2 Tax=Acidovorax RepID=A1W200_ACISJ	-	-	1.0e-39	100%
FL-Next	tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis).	-	-	0.0	58%
Sma3	Heavy metal ATPase	-	-	1.583e-23	-

Source	ECs	Term	Type	e value	Identity
Sma3	Copper-exporting ATPase.	EC:3.6.3.4	-	3.252e-29	-

Source	Gene names
Sma3	At1g63440; At5g44790; CHLREDRAFT_195962; CHLREDRAFT_205938; CHLREDRAFT_206047; CTP1; CTP2; CTP3; F2K11.18; GSVIVT00000399001; GSVIVT00000403001; GSVIVT00000405001; GSVIVT00024633001; GSVIVT00030125001; GSVIVT00032280001; HMA2; HMA3; HMA4; HMA5; HMA8; K23L

Source	GOs	Term	Type	Identity
Sma3	intracellular	GO:0005622	Cellular Component	-
Sma3	Golgi apparatus	GO:0005794	Cellular Component	-
Sma3	chloroplast	GO:0009507	Cellular Component	-
Sma3	membrane	GO:0016020	Cellular Component	-
Sma3	integral to membrane	GO:0016021	Cellular Component	-
Sma3	magnesium ion binding	GO:0000287	Molecular Function	-
Sma3	copper-exporting ATPase activity	GO:0004008	Molecular Function	-
Sma3	Rab GTPase activator activity	GO:0005097	Molecular Function	-
Sma3	cation channel activity	GO:0005261	Molecular Function	-
Sma3	copper ion binding	GO:0005507	Molecular Function	-
Sma3	ATP binding	GO:0005524	Molecular Function	-
Sma3	ATPase activity, coupled to transmembrane movement of ions, phosphorylative mechanism	GO:0015662	Molecular Function	-
Sma3	metal ion binding	GO:0046872	Molecular Function	-
Sma3	ATP biosynthetic process	GO:0006754	Biological Process	-
Sma3	copper ion transport	GO:0006825	Biological Process	-
Sma3	ethylene mediated signaling pathway	GO:0009873	Biological Process	-
Sma3	regulation of stomatal movement	GO:0010119	Biological Process	-
Sma3	detoxification of copper ion	GO:0010273	Biological Process	-
Sma3	metal ion transport	GO:0030001	Biological Process	-
Sma3	regulation of Rab GTPase activity	GO:0032313	Biological Process	-

Source	InterPros	Term	Type	Identity
Sma3	Cof protein	IPR000150	-	-
Sma3	Peptidase, cysteine peptidase active site	IPR000169	-	-
Sma3	Rab-GTPase-TBC domain	IPR000195	-	-
Sma3	Peptidase S8/S53, subtilisin/kexin/sedolisin	IPR000209	-	-
Sma3	Flagellar motor protein MotA, conserved site	IPR000540	-	-
Sma3	ATPase, P-type, H+ transporting proton pump	IPR000695	-	-
Sma3	ATPase, P-type, cadmium-transporting	IPR001366	-	-
Sma3		IPR001756	-	-
Sma3	ATPase, P-type, K/Mg/Cd/Cu/Zn/Na/Ca/Na/H-transporter	IPR001757	-	-
Sma3		IPR001877	-	-
Sma3	Haloacid dehalogenase-like hydrolase	IPR005834	-	-
Sma3	Heavy metal-associated domain, HMA	IPR006121	-	-
Sma3	Heavy metal-associated domain, copper ion-binding	IPR006122	-	-
Sma3	ATPase, P type, cation/copper-transporter	IPR006403	-	-
Sma3	ATPase, P-type, heavy metal-(Cd/Co/Hg/Pb/Zn)-translocating	IPR006404	-	-
Sma3	ATPase, P-type, heavy metal translocating	IPR006416	-	-
Sma3	ATPase, P-type, ATPase-associated domain	IPR008250	-	-
Sma3	Tachykinin/Neurokinin-like, conserved site	IPR013055	-	-
Sma3	Beta tubulin, autoregulation binding site	IPR013838	-	-
Sma3	Heavy-metal-associated, conserved site	IPR017969	-	-
Sma3	Glycoside hydrolase, family 1, active site	IPR018120	-	-
Sma3	ATPase, P-type phosphorylation site	IPR018303	-	-

Source	Species	ID	Description	e value	Identity
ATG	Arabidoptis thaliana	AT1G63440.1	HMA5 heavy metal atpase 5 chr1:23527655-23531109 FORWARD LENGTH=995	1.0e-24	57%
RefSeq	Arabidopsis thaliana	NP_176533.1	Cu2+-exporting ATPase [Arabidopsis thaliana]	2.0e-24	57%
RefSeq	Populus trichocarpa	XP_002303581.1	heavy metal ATPase [Populus trichocarpa]	5.0e-25	60%

Full-Lengther Next Prediction

Fln status: Internal

Fln database: coniferopsida.fasta

Fln subject: B8LQ20

Fln msg: Distance to subject end: 45 aas, your sequence is shorter than subject: 83 - 998

Fln protein: MVGDGVNDAPALAAADVGMAMGNGTDVAMHAAGITLMRGDPQLVAAALDISRRTVAKIRQNLFWAFAYNVAGIPLAALGYLSP

Protein Length: 84

Fln nts: CCATGGTGGGCGACGGCGTGAATGACGCGCCCGCGCTGGCCGCGGCCGATGTGGGCATGGCCATGGGCAATGGTACCGACGTGGCCATGCACGCGGCGGGCATCACGCTGATGCGCGGCGACCCGCAATTGGTGGCGGCGGCGCTGGACATCTCGCGGCGCACGGTGGCCAAGATCCGCCAGAACCTGTTTTGGGCCTTTGCATACAACGTGGCCGGTATTCCGCTGGCGGCGCTGGGCTACCTGAGTCCCG

Fln Alignment:

GDTE5QK01CA3KD___MVGDGVNDAPALAAADVGMAMGNGTDVAMHAAGITLMRGDPQLVAAALDISRRTVAKIRQNLFWAFAYNVAGIPLAA
B8LQ20_______________MVGDGINDSPALAAADVGMAIGAGTDIAIEAADYVLMRNNLEDVITAIDLSKKTFARIRLNYVFAMGYNIFAIPLAA

Back

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain