|
||||||
|
UniGene Name: sp_v3.0_unigene81241
Length: 112 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene81241
A |
|
Ace file of the UniGene sp_v3.0_unigene81241
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Endo-beta-1,4-glucanase n=1 Tax=Pinus radiata RepID=O64401_PINRA | - | - | 5.0e-13 | 89% |
| FL-Next | tr=Endo-beta-1,4-glucanase; Pinus radiata (Monterey pine) (Pinus insignis). | - | - | 0.0 | 89% |
| Sma3 | Endo-1,4-beta-glucanase | - | - | 4.721e-40 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Cellulase. | EC:3.2.1.4 | - | 0.0 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Starch and sucrose metabolism | 00500 | 0.0 | % |
| Source | Gene names |
|---|---|
| Sma3 | AT5G49720; Al-cel1; At1g02800; At1g22880; At1g23210; At1g64390; At1g70710; At1g71380; At2g32990; At2g44540; At2g44550; At2g44560; At2g44570; At3g43860; At4g02290; At4g11050; At4g24260; At4g38990; At4g39000; At4g39010; At5g49720; B1011A07.26; B1339H09.3; C |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | extracellular region | GO:0005576 | Cellular Component | 0.0 | - |
| Sma3 | mitochondrion | GO:0005739 | Cellular Component | 0.0 | - |
| Sma3 | early endosome | GO:0005769 | Cellular Component | 0.0 | - |
| Sma3 | Golgi apparatus | GO:0005794 | Cellular Component | 0.0 | - |
| Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
| Sma3 | cell plate | GO:0009504 | Cellular Component | 0.0 | - |
| Sma3 | plant-type cell wall | GO:0009505 | Cellular Component | 0.0 | - |
| Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
| Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
| Sma3 | hydrolase activity, hydrolyzing O-glycosyl compounds | GO:0004553 | Molecular Function | 0.0 | - |
| Sma3 | NADH dehydrogenase (ubiquinone) activity | GO:0008137 | Molecular Function | 0.0 | - |
| Sma3 | cellulase activity | GO:0008810 | Molecular Function | 0.0 | - |
| Sma3 | transferase activity | GO:0016740 | Molecular Function | 0.0 | - |
| Sma3 | carbohydrate binding | GO:0030246 | Molecular Function | 0.0 | - |
| Sma3 | carbohydrate metabolic process | GO:0005975 | Biological Process | 0.0 | - |
| Sma3 | cellular cell wall organization | GO:0007047 | Biological Process | 0.0 | - |
| Sma3 | pattern specification process | GO:0007389 | Biological Process | 0.0 | - |
| Sma3 | response to nematode | GO:0009624 | Biological Process | 0.0 | - |
| Sma3 | unidimensional cell growth | GO:0009826 | Biological Process | 0.0 | - |
| Sma3 | fruit ripening | GO:0009835 | Biological Process | 0.0 | - |
| Sma3 | cellulose biosynthetic process | GO:0030244 | Biological Process | 0.0 | - |
| Sma3 | cellulose catabolic process | GO:0030245 | Biological Process | 0.0 | - |
| Sma3 | hyperosmotic salinity response | GO:0042538 | Biological Process | 0.0 | - |
| Sma3 | cell wall modification involved in multidimensional cell growth | GO:0042547 | Biological Process | 0.0 | - |
| Sma3 | cortical microtubule organization | GO:0043622 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Glycoside hydrolase, family 9 | IPR001701 | - | 0.0 | - |
| Sma3 | Six-hairpin glycosidase | IPR012341 | - | 0.0 | - |
| Sma3 | NADH:ubiquinone oxidoreductase, B12 subunit | IPR012576 | - | 0.0 | - |
| Sma3 | Glycoside hydrolase, family 9, active site | IPR018221 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT4G39010.1 | AtGH9B18, GH9B18 glycosyl hydrolase 9B18 chr4:18176162-18179102 REVERSE LENGTH=497 | 2.0e-16 | 81% |
| RefSeq | Arabidopsis thaliana | NP_568050.1 | endoglucanase 24 [Arabidopsis thaliana] | 2.0e-16 | 81% |
| RefSeq | Populus trichocarpa | XP_002327063.1 | predicted protein, partial [Populus trichocarpa] | 5.0e-17 | 83% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: O64401
Fln msg: Distance to subject end: 391 aas, your sequence is shorter than subject: 37 - 510
Fln protein:
D
Protein Length:
38
Fln nts:
A
Fln Alignment:
GDTE5QK01EIL2N___DGFDQNVDLVGGYYDAGDNIKFGFPMAFTTTMLAWSV
O64401_______________DGFSQHVDLVGGYYDAGDNVKFGFPMAFTTTMLSWSV
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
